DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Plzf and Zbtb6

DIOPT Version :9

Sequence 1:NP_001285862.1 Gene:Plzf / 34622 FlyBaseID:FBgn0032401 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_666365.1 Gene:Zbtb6 / 241322 MGIID:2442998 Length:423 Species:Mus musculus


Alignment Length:478 Identity:96/478 - (20%)
Similarity:157/478 - (32%) Gaps:150/478 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLHSQTMQSIPTLHQPLHSKVSNYLNNQRRTGQFCDLLLELDSDDSLSLSVHFCVLAAQSQFINS 65
            :||.|..|....:.|.        :|..|:...|||:.:.::..:   ...|..:|||.|.|:  
Mouse     7 VLHFQFEQQGDVVLQK--------MNLLRQQNLFCDVSIYINDTE---FQGHKVILAACSTFM-- 58

  Fly    66 NQKQQQF----SIHNPLKITIRN---------FSCTQCLHTIVDFFYEDLVSVSKEHELHFRELA 117
               :.||    |.|  ::|||..         .||           |...:.|.::..|.:...|
Mouse    59 ---RDQFLLTQSKH--VRITILQSAEVGWKLLLSC-----------YTGALEVKRKELLKYLTAA 107

  Fly   118 QILAV-------TELLNLY-QLQPLGEAKEATEIPAPGEA-----QPNPDPEKKAEAVFE----N 165
            ..|.:       ||.|:.| ::....:..:.|::....:.     :.|.|.:.:...:.|    |
Mouse   108 SYLQMVHIVEKCTEALSKYLEIDLSMKNNQHTDLCQSSDTDVKNEEENSDKDCEIIEISEDSPVN 172

  Fly   166 RQSYFKLKNPRAVKSSSKVNYCIGCDFKCYQVQKMIEHMGSCEPSHLICSLCEVGFLDWREYDTH 230
            ...:.|.:...|::|:::.              ...|.|....|.   .|..:.||.:......|
Mouse   173 LDFHVKEEESNALQSAAET--------------LTSERMRMQSPE---LSAVDGGFKENEICILH 220

  Fly   231 LRR------HSGDLRKPFFCLQCGIRFNTRAALLVHQPKHS--TETP------------------ 269
            :..      .:|...:|....:.||.|......|::....:  ||.|                  
Mouse   221 VESISTDDVENGQFSQPCTSSKAGIYFPETQHSLINSTVENRVTEVPGNTNQGLFSENSDGSHGT 285

  Fly   270 --------------HICPHCGKGFKWKQGLSNHILVHNPEKQMLCDVCGYSTTHMKALKSHKLLH 320
                          |.||.|.:||...:....|:.:|   |..||..||.:.|            
Mouse   286 VNEIQNLDENFSLRHQCPRCPRGFLHVENYLRHLKMH---KLFLCLQCGKTFT------------ 335

  Fly   321 TGEFFACTVSGCKHRANRKENLKLHIETHKQGRDFICEVCGCKFSQSKNLKRHALKHTENGPNRY 385
                             :|:||..||..|...|.|.|.||...|:....|:.|...|:.:.|  |
Mouse   336 -----------------QKKNLNRHIRGHMGIRPFQCTVCLKTFTAKSTLQDHLNIHSGDRP--Y 381

  Fly   386 KCQLCGFSSHRSDKMKEHVQRVH 408
            ||..|.........:|:|:..||
Mouse   382 KCHCCDMDFKHKSALKKHLTSVH 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PlzfNP_001285862.1 COG5048 <193..403 CDD:227381 51/249 (20%)
C2H2 Zn finger 214..234 CDD:275368 4/25 (16%)
C2H2 Zn finger 244..264 CDD:275368 4/19 (21%)
C2H2 Zn finger 272..292 CDD:275368 6/19 (32%)
C2H2 Zn finger 300..320 CDD:275368 4/19 (21%)
C2H2 Zn finger 330..349 CDD:275368 5/18 (28%)
C2H2 Zn finger 357..377 CDD:275368 6/19 (32%)
C2H2 Zn finger 387..408 CDD:275368 4/20 (20%)
Zbtb6NP_666365.1 BTB 23..123 CDD:279045 27/120 (23%)
BTB 34..127 CDD:197585 24/113 (21%)
C2H2 Zn finger 302..322 CDD:275368 6/19 (32%)
zf-C2H2 325..347 CDD:278523 10/50 (20%)
C2H2 Zn finger 327..347 CDD:275368 9/48 (19%)
zf-H2C2_2 339..363 CDD:290200 10/23 (43%)
C2H2 Zn finger 355..375 CDD:275368 6/19 (32%)
C2H2 Zn finger 383..400 CDD:275368 3/16 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.