Sequence 1: | NP_001285862.1 | Gene: | Plzf / 34622 | FlyBaseID: | FBgn0032401 | Length: | 469 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001129248.1 | Gene: | ZBTB43 / 23099 | HGNCID: | 17908 | Length: | 467 | Species: | Homo sapiens |
Alignment Length: | 221 | Identity: | 48/221 - (21%) |
---|---|---|---|
Similarity: | 73/221 - (33%) | Gaps: | 64/221 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 101 DLVSVSKEHELHFRELAQILAVTELLNLYQ----LQPLGEAKEATEIPAPGEAQPNPDPEKKAEA 161
Fly 162 VFENR--------------QSYFKLKNPR--------------AVKSSSKVNYCIGCDFKCYQVQ 198
Fly 199 KMIEHMGSCEPSHLICSLCEVGFLDWREYDTHLRRHSGDLRKPFFCLQCGIRFNTRAALLVHQPK 263
Fly 264 HSTETPHICPHCGKGFKWKQGLSNHI 289 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Plzf | NP_001285862.1 | COG5048 | <193..403 | CDD:227381 | 24/97 (25%) |
C2H2 Zn finger | 214..234 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 244..264 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 272..292 | CDD:275368 | 6/18 (33%) | ||
C2H2 Zn finger | 300..320 | CDD:275368 | |||
C2H2 Zn finger | 330..349 | CDD:275368 | |||
C2H2 Zn finger | 357..377 | CDD:275368 | |||
C2H2 Zn finger | 387..408 | CDD:275368 | |||
ZBTB43 | NP_001129248.1 | BTB_POZ_ZBTB43 | 8..128 | CDD:349536 | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 134..153 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 162..225 | ||||
C2H2 Zn finger | 376..394 | CDD:275368 | 4/17 (24%) | ||
C2H2 Zn finger | 402..422 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 414..437 | CDD:404364 | 7/22 (32%) | ||
C2H2 Zn finger | 430..447 | CDD:275368 | 5/16 (31%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |