DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Plzf and Zbtb8b

DIOPT Version :9

Sequence 1:NP_001285862.1 Gene:Plzf / 34622 FlyBaseID:FBgn0032401 Length:469 Species:Drosophila melanogaster
Sequence 2:XP_006502990.1 Gene:Zbtb8b / 215627 MGIID:2387181 Length:517 Species:Mus musculus


Alignment Length:519 Identity:109/519 - (21%)
Similarity:179/519 - (34%) Gaps:131/519 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SKVSNYLNNQRRTGQFCDLLLELDSDDSLSLSVHFCVLAAQSQFINSNQKQ--QQFSIHNPLKIT 81
            :|:...||.||:...|||..:.:   :......|..:|.|.|.:..:....  |....|:...:.
Mouse    41 AKLLGELNEQRKRDFFCDCSIIV---EGRIFKAHRNILFANSGYFRALLLHYIQDSGRHSTASLD 102

  Fly    82 IRNFSCTQCLHTIVDFFYEDLVSVSKEHELHFRELAQILAVTELLNL---YQLQPLG-------E 136
            |   ..:....||:||.|...:.:..|:.:.....|..|.:.|::|.   |....|.       |
Mouse   103 I---VTSDAFSTILDFLYSGKLDLCGENVIEVMSAASYLQMNEVVNFCKTYIRSSLDICRKMEKE 164

  Fly   137 AKEATEIPAPGEAQ-------PNPDPEKKAEAVFENRQSYFKLKNPRAVKSSSKVNYCI-GCDFK 193
            |..|..:.|...|.       .:..|....|......:|:  :.:|  |.....::..| .||  
Mouse   165 AAVAAAMAAAAAAAAAAAHQIDSESPSSGLEGTSCGTKSF--VSSP--VDGEGSLDCTISSCD-- 223

  Fly   194 CYQVQKMIEHMGSCEPSHLIC-----------SLC--------EVGFLDWR---EYDTHLRRHSG 236
                        .|.|..|:.           .||        :|.|...|   |.|..|::::.
Mouse   224 ------------DCHPLELVAKDSQGSGVSDNDLCVVPRRVEPKVEFDVARVEVEADEQLQQYAA 276

  Fly   237 DLRKPFFCLQCGIRFNTRAALLVHQPKH--------------STETPHICPHCGKGFK------- 280
                |...::.|:..| :|..|.:...|              .::....| |..:|.:       
Mouse   277 ----PLAHMEEGLPSN-QALDLTYNSYHVKQFLEALLRNGAVQSKDDLDC-HSSRGLEGRLEGPG 335

  Fly   281 ------------WKQGLSNHILVHNPEKQMLCDVCGYSTTHMKALKSHKLLHTGEF-FACTVSGC 332
                        |.:..:..:|| .|.|...|..|.|:......||.|...||||. :.|..  |
Mouse   336 VAMSSVMDVQNDWYREDAGDVLV-VPIKLHRCPFCPYTAKQKGILKRHIRSHTGERPYPCET--C 397

  Fly   333 KHRANRKENLKLH-IETHKQGRDFICEVCGCKFSQSKNLKRHALKHTENGPNRYKCQLCGFSSHR 396
            ..|..|:|:|:.| :..|:..|..||:.|          :|....|...|..|:  .||...:..
Mouse   398 GKRFTRQEHLRSHALSVHRSSRPIICKGC----------RRTFTSHLSQGLRRF--GLCDSCTCV 450

  Fly   397 SDKMKEHVQRVHTEKPVQLEL----SETVDSSFPDDFELPVIETSPKKKPKSVKSKTIRNVNPD 456
            :|..:|....:    ||.|.|    ||:.:.|..||:.: .||:..:..|.:..|....::.|:
Mouse   451 TDPQEEEDDLM----PVNLSLVEASSESHEKSDTDDWPI-YIESGEENDPTAEDSDDKPHIRPN 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PlzfNP_001285862.1 COG5048 <193..403 CDD:227381 54/266 (20%)
C2H2 Zn finger 214..234 CDD:275368 8/41 (20%)
C2H2 Zn finger 244..264 CDD:275368 4/19 (21%)
C2H2 Zn finger 272..292 CDD:275368 5/38 (13%)
C2H2 Zn finger 300..320 CDD:275368 6/19 (32%)
C2H2 Zn finger 330..349 CDD:275368 6/19 (32%)
C2H2 Zn finger 357..377 CDD:275368 3/19 (16%)
C2H2 Zn finger 387..408 CDD:275368 4/20 (20%)
Zbtb8bXP_006502990.1 BTB_POZ_ZBTB8B 39..151 CDD:349639 25/115 (22%)
zf-H2C2_5 364..388 CDD:404746 7/23 (30%)
C2H2 Zn finger 366..386 CDD:275368 6/19 (32%)
zf-H2C2_2 379..403 CDD:404364 10/25 (40%)
C2H2 Zn finger 394..415 CDD:275368 7/22 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.