DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Plzf and ZBTB7C

DIOPT Version :9

Sequence 1:NP_001285862.1 Gene:Plzf / 34622 FlyBaseID:FBgn0032401 Length:469 Species:Drosophila melanogaster
Sequence 2:XP_016881094.1 Gene:ZBTB7C / 201501 HGNCID:31700 Length:668 Species:Homo sapiens


Alignment Length:497 Identity:107/497 - (21%)
Similarity:173/497 - (34%) Gaps:147/497 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PLH-SKVSNYLNNQRRTGQFCDLLLELDSDDSLSLSVHFCVLAAQSQFINSNQKQQQFS----IH 75
            |.| |:|...||.||..|..||:||.:...:   ...|..||||.|::.     ::.|:    ..
Human    63 PNHSSEVLCSLNEQRHDGLLCDVLLVVQEQE---YRTHRSVLAACSKYF-----KKLFTAGTLAS 119

  Fly    76 NPLKITIRNFSCTQCLHTIVDFFYEDLVSVSKEHELHFRELAQILAVTELLN--LYQLQPLGEAK 138
            .|....| :|...:.|..|::|.|...::::..:..|....|::|.:..::|  |..::|.|:..
Human   120 QPYVYEI-DFVQPEALAAILEFAYTSTLTITAGNVKHILNAARMLEIQCIVNVCLEIMEPGGDGG 183

  Fly   139 EATEIPAPGEAQPNPDPEKKAEAVFENRQ---------SYFKLKNPRAVKSSSKVNYCIGCDFKC 194
            |..:.....:.:.:.|.|.:.|...|...         ....|.:|:              |..|
Human   184 EEDDKEDDDDDEDDDDEEDEEEEEEEEEDDDDDTEDFADQENLPDPQ--------------DISC 234

  Fly   195 YQVQKMIEHMGSCEPSHLICSLCEVGFLDW-REYDTHLRR----HSGDLRKPFFCLQCGIRFN-- 252
            :|.....:|            |.|..:.|. |::....:.    |.|.:|.  |.::..:|.|  
Human   235 HQSPSKTDH------------LTEKAYSDTPRDFPDSFQAGSPGHLGVIRD--FSIESLLRENLY 285

  Fly   253 TRAALLVHQPKHSTETPHICPHCGKG--------------------------------------- 278
            .:|.:...:|..|...|...||...|                                       
Human   286 PKANIPDRRPSLSPFAPDFFPHLWPGDFGAFAQLPEQPMDSGPLDLVIKNRKIKEEEKEELPPPP 350

  Fly   279 --------FK----------------------WKQGLS-NHI--------LVH----NPEKQMLC 300
                    ||                      :...|| .|:        ||.    .|:....|
Human   351 PPPFPNDFFKDMFPDLPGGPLGPIKAENDYGAYLNFLSATHLGGLFPPWPLVEERKLKPKASQQC 415

  Fly   301 DVCGYSTTHMKALKSHKLLHTGEF-FACTVSGCKHRANRKENLKLHIETHKQGRDFICEVCGCKF 364
            .:|.........|..|...||||. :.||:  |:.|..|::.||:|:..|...|.::|..|..||
Human   416 PICHKVIMGAGKLPRHMRTHTGEKPYMCTI--CEVRFTRQDKLKIHMRKHTGERPYLCIHCNAKF 478

  Fly   365 SQSKNLKRHALKHTENGPNRYKCQLCGFSSHRSDKMKEHVQR 406
            ..:.:||.|...||  |...|:|:.|..|..|||.:..|::|
Human   479 VHNYDLKNHMRIHT--GVRPYQCEFCYKSFTRSDHLHRHIKR 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PlzfNP_001285862.1 COG5048 <193..403 CDD:227381 63/299 (21%)
C2H2 Zn finger 214..234 CDD:275368 4/24 (17%)
C2H2 Zn finger 244..264 CDD:275368 4/21 (19%)
C2H2 Zn finger 272..292 CDD:275368 9/97 (9%)
C2H2 Zn finger 300..320 CDD:275368 4/19 (21%)
C2H2 Zn finger 330..349 CDD:275368 6/18 (33%)
C2H2 Zn finger 357..377 CDD:275368 7/19 (37%)
C2H2 Zn finger 387..408 CDD:275368 8/20 (40%)
ZBTB7CXP_016881094.1 BTB 73..176 CDD:279045 28/111 (25%)
BTB 84..177 CDD:197585 22/101 (22%)
C2H2 Zn finger 415..435 CDD:275368 4/19 (21%)
zf-H2C2_2 430..452 CDD:290200 9/23 (39%)
C2H2 Zn finger 443..463 CDD:275368 8/21 (38%)
zf-H2C2_2 456..480 CDD:290200 9/23 (39%)
C2H2 Zn finger 471..491 CDD:275368 7/19 (37%)
zf-H2C2_2 483..508 CDD:290200 10/26 (38%)
C2H2 Zn finger 499..517 CDD:275368 7/17 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.