Sequence 1: | NP_001285862.1 | Gene: | Plzf / 34622 | FlyBaseID: | FBgn0032401 | Length: | 469 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_494634.1 | Gene: | sdz-12 / 184388 | WormBaseID: | WBGene00017406 | Length: | 330 | Species: | Caenorhabditis elegans |
Alignment Length: | 301 | Identity: | 64/301 - (21%) |
---|---|---|---|
Similarity: | 94/301 - (31%) | Gaps: | 88/301 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 179 KSSSKVNYCIGCDFKCYQVQKMIEHMG--SCEP--SHLI-----CSLCEVGFLDWREYDTHLRRH 234
Fly 235 SGDLRKPFFCLQCGIRFNTRAALLVHQPKHSTETPHI-CP--HCGKGFKWKQGLSNHILVHNPEK 296
Fly 297 QMLCDVCG---------------YSTTHMKALKSHKLLHTGEF----FACTVSG----------- 331
Fly 332 --------------------CKHRA----NRKENLK----------LHIETHKQGRDFICEVCGC 362
Fly 363 KFSQSKNLKRHALKHTENGPNRYKCQLCG--------FSSH 395 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Plzf | NP_001285862.1 | COG5048 | <193..403 | CDD:227381 | 59/287 (21%) |
C2H2 Zn finger | 214..234 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 244..264 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 272..292 | CDD:275368 | 7/21 (33%) | ||
C2H2 Zn finger | 300..320 | CDD:275368 | 7/34 (21%) | ||
C2H2 Zn finger | 330..349 | CDD:275368 | 5/63 (8%) | ||
C2H2 Zn finger | 357..377 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 387..408 | CDD:275368 | 5/17 (29%) | ||
sdz-12 | NP_494634.1 | SFP1 | <25..86 | CDD:227516 | 15/60 (25%) |
C2H2 Zn finger | 29..48 | CDD:275368 | 5/18 (28%) | ||
COG5236 | <32..>197 | CDD:227561 | 40/166 (24%) | ||
C2H2 Zn finger | 65..85 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 93..113 | CDD:275368 | 5/19 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |