DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Plzf and sdz-12

DIOPT Version :9

Sequence 1:NP_001285862.1 Gene:Plzf / 34622 FlyBaseID:FBgn0032401 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_494634.1 Gene:sdz-12 / 184388 WormBaseID:WBGene00017406 Length:330 Species:Caenorhabditis elegans


Alignment Length:301 Identity:64/301 - (21%)
Similarity:94/301 - (31%) Gaps:88/301 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 KSSSKVNYCIGCDFKCYQVQKMIEHMG--SCEP--SHLI-----CSLCEVGFLDWREYDTHLRRH 234
            :.|:||..|..|..|....:.:..||.  :|.|  |:::     |..||..|.:......|...|
 Worm    21 QDSAKVPQCQVCKRKFANQKTLRTHMKHITCRPGRSNVVNHKFRCENCEKQFTNKPNLKRHQITH 85

  Fly   235 SGDLRKPFFCLQCGIRFNTRAALLVHQPKHSTETPHI-CP--HCGKGFKWKQGLSNHILVHNPEK 296
            ||...|.  |..|...|.....|..|...|..|..|. ||  :|...|.:.:|:.||::.|:...
 Worm    86 SGSKSKK--CSTCQRTFFREDQLQRHLHNHLKERSHFDCPVLNCSMQFVFYEGVENHLVNHHHFS 148

  Fly   297 QMLCDVCG---------------YSTTHMKALKSHKLLHTGEF----FACTVSG----------- 331
            ......||               |...|.:||:|.....|...    ...:.||           
 Worm   149 YSESAPCGKCHKLFGSPRHLLVHYHFDHKEALRSSAPAPTSSARLSPITVSTSGSPRAQLAISPQ 213

  Fly   332 --------------------CKHRA----NRKENLK----------LHIETHKQGRDFICEVCGC 362
                                |:..:    |..:.|.          .::.|.:....|.|:.|..
 Worm   214 EKPPQKLSINLGTSPMIEEFCEQNSATLPNTDQQLSPTLSPNEPRFRNLITSEPTPSFECKHCTI 278

  Fly   363 KFSQSKNLKRHALKHTENGPNRYKCQLCG--------FSSH 395
            ||..:.....|...|....|  :||.:||        |:.|
 Worm   279 KFHDATMSIMHNALHAPGSP--FKCAICGAECGNKIVFTMH 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PlzfNP_001285862.1 COG5048 <193..403 CDD:227381 59/287 (21%)
C2H2 Zn finger 214..234 CDD:275368 5/19 (26%)
C2H2 Zn finger 244..264 CDD:275368 5/19 (26%)
C2H2 Zn finger 272..292 CDD:275368 7/21 (33%)
C2H2 Zn finger 300..320 CDD:275368 7/34 (21%)
C2H2 Zn finger 330..349 CDD:275368 5/63 (8%)
C2H2 Zn finger 357..377 CDD:275368 5/19 (26%)
C2H2 Zn finger 387..408 CDD:275368 5/17 (29%)
sdz-12NP_494634.1 SFP1 <25..86 CDD:227516 15/60 (25%)
C2H2 Zn finger 29..48 CDD:275368 5/18 (28%)
COG5236 <32..>197 CDD:227561 40/166 (24%)
C2H2 Zn finger 65..85 CDD:275368 5/19 (26%)
C2H2 Zn finger 93..113 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.