DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Plzf and Zbtb7a

DIOPT Version :9

Sequence 1:NP_001285862.1 Gene:Plzf / 34622 FlyBaseID:FBgn0032401 Length:469 Species:Drosophila melanogaster
Sequence 2:XP_006240898.1 Gene:Zbtb7a / 117107 RGDID:620946 Length:648 Species:Rattus norvegicus


Alignment Length:543 Identity:101/543 - (18%)
Similarity:162/543 - (29%) Gaps:227/543 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PLHSK-VSNYLNNQRRTGQFCDLLLELDSDDSLSLSVHFCVLAAQSQFINS-------NQKQQQF 72
            |.||. :.:.||.||..|..||:::.::..:   ...|..||||.||:...       ..:|..:
  Rat    93 PDHSSDILSGLNEQRTQGLLCDVVILVEGRE---FPTHRSVLAACSQYFKKLFTSGAVVDQQNVY 154

  Fly    73 SIHNPLKITIRNFSCTQCLHTIVDFFYEDLVSVSKEHELHFRELAQILAV-------TELLNLYQ 130
            .|         :|...:.|..::||.|...::||..:.......|::|.:       |:||....
  Rat   155 EI---------DFVSAEALTALMDFAYTATLTVSTANVGDILSAARLLEIPAVSRVCTDLLERQI 210

  Fly   131 L---------QPLG----------EAKEATE---------IPA-----PGEAQPNPDPEKKAEAV 162
            |         ||.|          .|||..|         :|.     ||.:.|:.|.:...|||
  Rat   211 LAADDVGDAGQPDGAGPTDQRNLLRAKEYLEFFRSNPMNSLPPTAFQWPGFSAPDDDLDATKEAV 275

  Fly   163 FENRQSYFKLKNPRAVKSSSKVNYCIGCDF----------------------------------- 192
                         .|..::.....|.|.||                                   
  Rat   276 -------------AAAVAAVAAGDCNGLDFYGPGPPADRPPTGDGEEGDSTPGLWPERDEDAPPG 327

  Fly   193 ----------------------------------------------------------------- 192
                                                                             
  Rat   328 GLFPPPTAPPATTQNGHYGRAGASTGEEEAVALSEAAPEPGDSPGFLSGAAEGEDGDAADVDGLA 392

  Fly   193 KCYQVQKMIEHMGSCEPSHLICSLCEVGFLDWREYDTHLR----RHSGDLRKPFFCLQCGIRFNT 253
            ....:|:|:..:|....|.......:.|.:|:     :|:    .|.||:...:  .|.|     
  Rat   393 ASTLLQQMMSSVGRAGDSDEESRPDDKGVMDY-----YLKYFSGAHEGDVYPAW--SQKG----- 445

  Fly   254 RAALLVHQPKHSTETPHICPHCGKGFKWKQGLSNHILVHNPEKQMLCDVCGYSTTHMKALKSHKL 318
                   :.|...:....||.|.|..:....|..||..|..||...|::                
  Rat   446 -------EKKIRAKAFQKCPICEKVIQGAGKLPRHIRTHTGEKPYECNI---------------- 487

  Fly   319 LHTGEFFACTVSGCKHRANRKENLKLHIETHKQGRDFICEVCGCKFSQSKNLKRHALKHTENGPN 383
                         ||.|..|::.||:|:..|...:.::|:.||..|:.:.:||.|...||  |..
  Rat   488 -------------CKVRFTRQDKLKVHMRKHTGEKPYLCQQCGAAFAHNYDLKNHMRVHT--GLR 537

  Fly   384 RYKCQLCGFSSHRSDKMKEHVQR 406
            .|:|..|..:..|||.:..|:::
  Rat   538 PYQCDSCCKTFVRSDHLHRHLKK 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PlzfNP_001285862.1 COG5048 <193..403 CDD:227381 48/213 (23%)
C2H2 Zn finger 214..234 CDD:275368 3/23 (13%)
C2H2 Zn finger 244..264 CDD:275368 2/19 (11%)
C2H2 Zn finger 272..292 CDD:275368 7/19 (37%)
C2H2 Zn finger 300..320 CDD:275368 1/19 (5%)
C2H2 Zn finger 330..349 CDD:275368 7/18 (39%)
C2H2 Zn finger 357..377 CDD:275368 7/19 (37%)
C2H2 Zn finger 387..408 CDD:275368 6/20 (30%)
Zbtb7aXP_006240898.1 BTB 103..206 CDD:279045 26/114 (23%)
BTB 114..210 CDD:197585 22/107 (21%)
COG5048 455..>518 CDD:227381 21/91 (23%)
C2H2 Zn finger 457..477 CDD:275368 7/19 (37%)
zf-H2C2_2 472..494 CDD:290200 9/50 (18%)
C2H2 Zn finger 485..505 CDD:275368 8/48 (17%)
zf-H2C2_2 498..522 CDD:290200 8/23 (35%)
C2H2 Zn finger 513..533 CDD:275368 7/19 (37%)
zf-H2C2_2 525..550 CDD:290200 9/26 (35%)
C2H2 Zn finger 541..559 CDD:275368 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.