DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Plzf and ZBTB6

DIOPT Version :9

Sequence 1:NP_001285862.1 Gene:Plzf / 34622 FlyBaseID:FBgn0032401 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_006617.1 Gene:ZBTB6 / 10773 HGNCID:16764 Length:424 Species:Homo sapiens


Alignment Length:475 Identity:91/475 - (19%)
Similarity:154/475 - (32%) Gaps:143/475 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLHSQTMQSIPTLHQPLHSKVSNYLNNQRRTGQFCDLLLELDSDDSLSLSVHFCVLAAQSQFINS 65
            :||.|..|....:.|.        :|..|:...|||:.:.::..:   ...|..:|||.|.|:  
Human     7 VLHFQFEQQGDVVLQK--------MNLLRQQNLFCDVSIYINDTE---FQGHKVILAACSTFM-- 58

  Fly    66 NQKQQQFSIHNPLKITIRNFSCTQCLHTIVDFFYEDLVSVSKEHELHFRELAQILAV-------T 123
               :.||.:.....:.|......:....::...|...:.|.::..|.:...|..|.:       |
Human    59 ---RDQFLLTQSKHVRITILQSAEVGRKLLLSCYTGALEVKRKELLKYLTAASYLQMVHIVEKCT 120

  Fly   124 ELLNLY-----QLQPLGEAKEATEIPAPGEAQPNPDPEKKAEAVFENRQSYFKLKNPRAVKSSSK 183
            |.|:.|     .::...:..:..:...|.....:.:.:|..|.:              .:...|.
Human   121 EALSKYLEIDLSMKNNNQHTDLCQSSDPDVKNEDENSDKDCEII--------------EISEDSP 171

  Fly   184 VNYCIGCDFKCYQ-----VQKMIEHMGS--CEPSHLICSLCEVGFLDWREYDTHLRR------HS 235
            ||    .||...:     :|..:|.:.|  .|......|..::||.|......|:..      .:
Human   172 VN----IDFHVKEEESNALQSTVESLTSERKEMKSPELSTVDIGFKDNEICILHVESISTAGVEN 232

  Fly   236 GDLRKPFFCLQCGIRFNTRAALLVHQPKHS----------TETP--------------------- 269
            |...:|  |.      :::|::...:.:||          .|.|                     
Human   233 GQFSQP--CT------SSKASMYFSETQHSLINSTVESRVAEVPGNQDQGLFCENTEGSYGTVSE 289

  Fly   270 -----------HICPHCGKGFKWKQGLSNHILVHNPEKQMLCDVCGYSTTHMKALKSHKLLHTGE 323
                       |.||.|.:||...:....|:.:|   |..||..||.:.|               
Human   290 IQNLEEGYSLRHQCPRCPRGFLHVENYLRHLKMH---KLFLCLQCGKTFT--------------- 336

  Fly   324 FFACTVSGCKHRANRKENLKLHIETHKQGRDFICEVCGCKFSQSKNLKRHALKHTENGPNRYKCQ 388
                          :|:||..||..|...|.|.|.||...|:....|:.|...|:.:.|  |||.
Human   337 --------------QKKNLNRHIRGHMGIRPFQCTVCLKTFTAKSTLQDHLNIHSGDRP--YKCH 385

  Fly   389 LCGFSSHRSDKMKEHVQRVH 408
            .|.........:|:|:..||
Human   386 CCDMDFKHKSALKKHLTSVH 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PlzfNP_001285862.1 COG5048 <193..403 CDD:227381 52/264 (20%)
C2H2 Zn finger 214..234 CDD:275368 5/25 (20%)
C2H2 Zn finger 244..264 CDD:275368 2/19 (11%)
C2H2 Zn finger 272..292 CDD:275368 6/19 (32%)
C2H2 Zn finger 300..320 CDD:275368 4/19 (21%)
C2H2 Zn finger 330..349 CDD:275368 5/18 (28%)
C2H2 Zn finger 357..377 CDD:275368 6/19 (32%)
C2H2 Zn finger 387..408 CDD:275368 4/20 (20%)
ZBTB6NP_006617.1 BTB_POZ_ZBTB6 8..123 CDD:349506 26/130 (20%)
C2H2 Zn finger 303..323 CDD:275368 6/19 (32%)
zf-C2H2 326..348 CDD:395048 10/50 (20%)
C2H2 Zn finger 328..348 CDD:275368 9/48 (19%)
zf-C2H2_8 331..401 CDD:406359 24/100 (24%)
zf-H2C2_2 340..364 CDD:404364 10/23 (43%)
C2H2 Zn finger 356..376 CDD:275368 6/19 (32%)
C2H2 Zn finger 384..401 CDD:275368 3/16 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 402..424 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.