DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Plzf and ZBTB42

DIOPT Version :9

Sequence 1:NP_001285862.1 Gene:Plzf / 34622 FlyBaseID:FBgn0032401 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001131073.1 Gene:ZBTB42 / 100128927 HGNCID:32550 Length:422 Species:Homo sapiens


Alignment Length:486 Identity:93/486 - (19%)
Similarity:146/486 - (30%) Gaps:169/486 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PLH-SKVSNYLNNQRRTGQFCDLLLELDSDDSLSLSVHFCVLAAQSQFINSNQKQQQFSIHNPLK 79
            |.| .::...|..||..|..||..: |..|  .....|..||||.|.:.:...:.:.....:.::
Human     4 PEHGGRLLGRLRQQRELGFLCDCTV-LVGD--ARFPAHRAVLAACSVYFHLFYRDRPAGSRDTVR 65

  Fly    80 ITIRNFSCTQCLHTIVDFFYE---DLVSVSKEHELHFRELAQILAVTELLNLYQLQPL--GEAKE 139
            :. .:.........::||.||   ||.|:..|         .:||....|::|.:..:  |..:|
Human    66 LN-GDIVTAPAFGRLLDFMYEGRLDLRSLPVE---------DVLAAASYLHMYDIVKVCKGRLQE 120

  Fly   140 ATEIPAPGEAQPNPDP-----------------EKKA-------EAVFENRQSYFKLKNPRAVKS 180
            ......||...|..:|                 .:||       :|....|.|     .|...:.
Human   121 KDRSLDPGNPAPGAEPAQPPCPWPVWTADLCPAARKAKLPPFGVKAALPPRAS-----GPPPCQV 180

  Fly   181 SSKVNYCIGCDFKCYQVQKMIEHMGSCEPSHLICSLCEVGFLDWREYDTHLRRHSGDLRKPFFCL 245
            ..:.:..:....|....|:.:.     .|..|...||.             :|..|  .:|    
Human   181 PEESDQALDLSLKSGPRQERVH-----PPCVLQTPLCS-------------QRQPG--AQP---- 221

  Fly   246 QCGIRFNTRAALLVHQPKHSTETPH---------------------------------------- 270
               :..:.|.:|...:...|:.:||                                        
Human   222 ---LVKDERDSLSEQEESSSSRSPHSPPKPPPVPAAKGLVVGLQPLPLSGEGSRELELGAGRLAS 283

  Fly   271 -----------ICPHCGKGFKWKQGLSNHILVHNPEKQM------------LCDVCGYSTTHMKA 312
                       |||.|.|.|.....|..|:..|..|:..            .|.:|         
Human   284 EDELGPGGPLCICPLCSKLFPSSHVLQLHLSAHFRERDSTRARLSPDGVAPTCPLC--------- 339

  Fly   313 LKSHKLLHTGEFFACTVSGCKHRANRKENLKLHIETHKQGRDFICEVCGCKFSQSKNLKRHALKH 377
                     |:.|:||.:           ||.|..||...:.:.|..||..|..|.||.||.:.|
Human   340 ---------GKTFSCTYT-----------LKRHERTHSGEKPYTCVQCGKSFQYSHNLSRHTVVH 384

  Fly   378 TENGPNRYKCQLCGFSSHRSDKMKEHVQRVH 408
            |...|  :.|:.|.....:|..:..||::.|
Human   385 TREKP--HACRWCERRFTQSGDLYRHVRKFH 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PlzfNP_001285862.1 COG5048 <193..403 CDD:227381 50/272 (18%)
C2H2 Zn finger 214..234 CDD:275368 2/19 (11%)
C2H2 Zn finger 244..264 CDD:275368 2/19 (11%)
C2H2 Zn finger 272..292 CDD:275368 7/19 (37%)
C2H2 Zn finger 300..320 CDD:275368 2/19 (11%)
C2H2 Zn finger 330..349 CDD:275368 3/18 (17%)
C2H2 Zn finger 357..377 CDD:275368 9/19 (47%)
C2H2 Zn finger 387..408 CDD:275368 5/20 (25%)
ZBTB42NP_001131073.1 BTB_POZ_ZBTB42 1..129 CDD:349737 31/137 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..141 4/19 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..188 4/26 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 207..256 11/70 (16%)
COG5048 <292..>405 CDD:227381 36/143 (25%)
C2H2 Zn finger 296..316 CDD:275368 7/19 (37%)
C2H2 Zn finger 336..356 CDD:275368 9/48 (19%)
zf-H2C2_2 349..371 CDD:338759 8/21 (38%)
C2H2 Zn finger 364..384 CDD:275368 9/19 (47%)
C2H2 Zn finger 392..410 CDD:275368 4/17 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.