DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Plzf and Zbtb48

DIOPT Version :9

Sequence 1:NP_001285862.1 Gene:Plzf / 34622 FlyBaseID:FBgn0032401 Length:469 Species:Drosophila melanogaster
Sequence 2:XP_017175372.1 Gene:Zbtb48 / 100090 MGIID:2140248 Length:767 Species:Mus musculus


Alignment Length:712 Identity:127/712 - (17%)
Similarity:203/712 - (28%) Gaps:331/712 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 HS-KVSNYLNNQRRTGQFCDLLLELDSDDSLSLSVHFCVLAAQSQFINSNQKQQQF------SIH 75
            || :|...||.||..||:||..|::   ..|....|:.|||..|.|.     |:.:      |:.
Mouse    38 HSVRVLQELNKQREKGQYCDATLDV---GGLVFKAHWSVLACCSHFF-----QRIYGDGTGGSVV 94

  Fly    76 NPLKITIRNFSCTQCLHTIVDFFYEDLVSVSKEHELHFRELAQILAVTELLNLYQ-LQP---LGE 136
            .|.       ...:....::||||...::::..:.......|:.|.|.|.:.|.| .||   :|:
Mouse    95 LPA-------GFAEIFGLLLDFFYTGHLALTSGNRDQVLLAAKELRVPEAVELCQSFQPQTSVGQ 152

  Fly   137 A----------------KEATEI------------------------------------------ 143
            |                ||.|::                                          
Mouse   153 AQSGLGQPASQDVKSHLKEPTDLDEEEVFRTLSLASVDQEPRDTEQPQLGTPAQSTTAFLCGKLT 217

  Fly   144 ----PAPGEAQPNPD---PEKKAEA-----------------VFENRQSYFKLKNPRAVKSSSKV 184
                |:|.|.:.:.|   |.:..||                 |.::|...: :..|..|.:..| 
Mouse   218 QALKPSPSEDKESEDCKEPPRPFEAGGAPLQGESNEWEVVVQVEDDRDGDY-VSEPETVLTRRK- 280

  Fly   185 NYCIGCDFKCYQVQKMIEHMGSCEPS-------------------HLICSLCEVGFLDWREYDTH 230
                         .|:|....:.||:                   .:.|..|...||.......|
Mouse   281 -------------SKVIRKPCAAEPALGAGSLTAEPTDSRKGAAVPVECPTCHKKFLSKYYLKVH 332

  Fly   231 LRRHSGDLRKPFFCLQCG-------------------------------IRFNTRAALLVHQPKH 264
            .|:|:|:  |||.|.:||                               ..|..|..|.:|...|
Mouse   333 NRKHTGE--KPFECPKCGKCYFRKENLLEHEARNCMNRSEQVFTCSVCQETFRRRMELRLHMVSH 395

  Fly   265 STETPHICPHCGKGFKWKQGLSNHIL-VHNP---------------------------------- 294
            :.|.|:.|..|.:.|..|:.|.:|:: :|..                                  
Mouse   396 TGEMPYKCSSCSQQFMQKKDLQSHMIKLHGAPKPHAVSASQGWGSGGSGTAQSCPHLDVLPLPVS 460

  Fly   295 ---------------------------EKQMLC-------------------------------- 300
                                       ||..||                                
Mouse   461 PTCSAPLVPSASCLGRSYSCTRLLSIVEKSSLCVRNAGTGPRAATDCRCTSRPSTGMKGLMSVSS 525

  Fly   301 ----------DVCGYSTTHMKALKS---------------------------------------H 316
                      ..|..:.|..::|.|                                       |
Mouse   526 AAMPSPRRPTSTCTCAHTPARSLSSATSVGRPSAPKVRQAQPLLAPGLRQPLSSTLSPIASLDKH 590

  Fly   317 KLLHTGEF-FACTVSGCKHRANRKENLKLHIET-HKQGRDFICEVCGCKFSQSKNLKRHALKHTE 379
            ...||||. |:|..  |:.|...|..|..|:.: |::||...|::||..|...:.|:.|..:|  
Mouse   591 NRTHTGERPFSCEF--CEQRFTEKGPLLRHVASRHQEGRPHFCQICGKTFKAVEQLRVHVRRH-- 651

  Fly   380 NGPNRYKCQLCGFSSHRSDKMKEHVQ---RVHTEKPVQLELSETVDSSFPDDFELPVIETSP 438
            .|..:::|..||:...|...::.|::   ||....|.|.:|...:    .:|.::.|:...|
Mouse   652 KGVRKFECTECGYKFTRQAHLRRHMEIHDRVENYNPRQRKLRNLI----IEDEKMVVVALQP 709

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PlzfNP_001285862.1 COG5048 <193..403 CDD:227381 67/404 (17%)
C2H2 Zn finger 214..234 CDD:275368 6/19 (32%)
C2H2 Zn finger 244..264 CDD:275368 7/50 (14%)
C2H2 Zn finger 272..292 CDD:275368 6/20 (30%)
C2H2 Zn finger 300..320 CDD:275368 6/100 (6%)
C2H2 Zn finger 330..349 CDD:275368 5/19 (26%)
C2H2 Zn finger 357..377 CDD:275368 6/19 (32%)
C2H2 Zn finger 387..408 CDD:275368 6/23 (26%)
Zbtb48XP_017175372.1 BTB_POZ_ZBTB48_TZAP_KR3 38..145 CDD:349541 32/121 (26%)
C2H2 Zn finger 316..336 CDD:275368 6/19 (32%)
zf-H2C2_2 328..351 CDD:372612 10/24 (42%)
C2H2 Zn finger 344..395 CDD:275368 7/50 (14%)
zf-H2C2_2 387..410 CDD:372612 7/22 (32%)
C2H2 Zn finger 403..424 CDD:275368 6/20 (30%)
PHA03247 <426..583 CDD:223021 8/156 (5%)
zf-H2C2_2 586..610 CDD:372612 9/25 (36%)
C2H2 Zn finger 602..623 CDD:275368 6/22 (27%)
C2H2 Zn finger 631..651 CDD:275368 6/19 (32%)
zf-H2C2_2 644..668 CDD:372612 7/25 (28%)
zf-C2H2 657..679 CDD:333835 5/21 (24%)
C2H2 Zn finger 659..679 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.