DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6770 and Nupr2

DIOPT Version :10

Sequence 1:NP_609539.1 Gene:CG6770 / 34621 FlyBaseID:FBgn0032400 Length:69 Species:Drosophila melanogaster
Sequence 2:NP_081192.2 Gene:Nupr2 / 69034 MGIID:1923099 Length:102 Species:Mus musculus


Alignment Length:42 Identity:15/42 - (35%)
Similarity:22/42 - (52%) Gaps:1/42 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SGHSGKQRNKREANEHTNHFDPSGHSRKILTKLMNTNNNNKK 63
            :|.| |.|.:||....||:..|.||.||:...|:|.....::
Mouse    50 AGRS-KGRTRREQQLRTNYPVPGGHERKVAQILLNGQRKRRQ 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6770NP_609539.1 Phospho_p8 3..55 CDD:462991 13/32 (41%)
Nupr2NP_081192.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
Phospho_p8 31..84 CDD:462991 14/34 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 46..102 15/42 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.