DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6770 and Nupr1

DIOPT Version :10

Sequence 1:NP_609539.1 Gene:CG6770 / 34621 FlyBaseID:FBgn0032400 Length:69 Species:Drosophila melanogaster
Sequence 2:NP_062712.1 Gene:Nupr1 / 56312 MGIID:1891834 Length:80 Species:Mus musculus


Alignment Length:58 Identity:26/58 - (44%)
Similarity:32/58 - (55%) Gaps:4/58 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DEYEHYNFDHDKHIFSGHSGKQRNKREANEHTNHFDPSGHSRKILTKLMNTNNNNKKA 64
            |||:.|:..|...:..|..|  |.||||..:||...|.||.||:|||..  |:..|||
Mouse    25 DEYDQYSLAHPCVVGGGRKG--RTKREAAANTNRPSPGGHERKLLTKFQ--NSERKKA 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6770NP_609539.1 Phospho_p8 3..55 CDD:462991 22/47 (47%)
Nupr1NP_062712.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Phospho_p8 24..77 CDD:462991 23/55 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..80 21/45 (47%)
Nuclear localization signal. /evidence=ECO:0000255 64..80 9/17 (53%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.