DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tom70 and AIP

DIOPT Version :9

Sequence 1:NP_609536.1 Gene:Tom70 / 34618 FlyBaseID:FBgn0032397 Length:589 Species:Drosophila melanogaster
Sequence 2:NP_003968.3 Gene:AIP / 9049 HGNCID:358 Length:330 Species:Homo sapiens


Alignment Length:169 Identity:42/169 - (24%)
Similarity:67/169 - (39%) Gaps:28/169 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 ELDGEKKRPKAKI---EKQAISLDGT-APDQELERNQKSAELGEKLSPLKEANNYKTEGNNCYRN 103
            :||..::.|:..|   |...:...|| ..|.....:::.|    |..||     ...|||..||.
Human   137 DLDALQQNPQPLIFHMEMLKVESPGTYQQDPWAMTDEEKA----KAVPL-----IHQEGNRLYRE 192

  Fly   104 GKYDE-AIKFYD----------KAIDKCPKEHRTDMAI--FYQNRAASYEMLKKWSNVKEDCTAS 155
            |...| |.|:||          |.....|:..:.|..|  ...|......:::::..|.:.|::.
Human   193 GHVKEAAAKYYDAIACLKNLQMKEQPGSPEWIQLDQQITPLLLNYCQCKLVVEEYYEVLDHCSSI 257

  Fly   156 LEFNPRYAKAYYRRARAHEATKDMNECLDDVTATCILEM 194
            |.......|||::|.:||.|..:..|...|...  :||:
Human   258 LNKYDDNVKAYFKRGKAHAAVWNAQEAQADFAK--VLEL 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tom70NP_609536.1 TPR_11 89..160 CDD:290150 19/83 (23%)
TPR repeat 90..118 CDD:276809 12/38 (32%)
TPR repeat 123..158 CDD:276809 6/36 (17%)
TPR repeat 296..324 CDD:276809
TPR_11 333..399 CDD:290150
TPR repeat 334..362 CDD:276809
TPR repeat 367..397 CDD:276809
TPR repeat 402..437 CDD:276809
TPR_16 413..477 CDD:290168
TPR repeat 443..471 CDD:276809
TPR repeat 476..507 CDD:276809
TPR_11 486..539 CDD:290150
TPR repeat 512..539 CDD:276809
AIPNP_003968.3 FKBP_C 29..>90 CDD:327575
TPR 1. /evidence=ECO:0000255, ECO:0000269|PubMed:23300914 179..212 13/37 (35%)
TPR repeat 183..225 CDD:276809 13/41 (32%)
TPR repeat 230..260 CDD:276809 5/29 (17%)
TPR 2. /evidence=ECO:0000269|PubMed:23300914 231..264 4/32 (13%)
TPR 3. /evidence=ECO:0000255, ECO:0000255|PROSITE-ProRule:PRU00339, ECO:0000269|PubMed:23300914 265..298 11/32 (34%)
TPR repeat 265..293 CDD:276809 9/29 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1535
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.