DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tom70 and Spag1

DIOPT Version :9

Sequence 1:NP_609536.1 Gene:Tom70 / 34618 FlyBaseID:FBgn0032397 Length:589 Species:Drosophila melanogaster
Sequence 2:NP_651514.1 Gene:Spag1 / 43239 FlyBaseID:FBgn0039463 Length:469 Species:Drosophila melanogaster


Alignment Length:306 Identity:74/306 - (24%)
Similarity:116/306 - (37%) Gaps:97/306 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 ELDGEKKRPKAKIEKQAISLDGTA------------------PDQEL-------ERNQKSAE--- 79
            :|:.|.|..|.|...:|.|...|.                  ||:|:       ||:|:..|   
  Fly   126 DLEKESKTEKPKPAPKATSPSNTKNKEARIKSTDYRKWDKYDPDEEILRMDLNEERDQEQREKII 190

  Fly    80 ------------------LGEK-------LSPLKE---ANNYKTEGNNCYRNGKYDEAIKFYDKA 116
                              |.|:       ||.|::   |..::..||..::..:|:.||:.|:.:
  Fly   191 SNHSKSVTTDKLQSERDSLYERLQAQLKNLSQLEKEQFAERHRLRGNESFKAKEYENAIEEYNCS 255

  Fly   117 IDKCPKEHRTDMAIF-YQNRAASYEMLKKWSNVKEDCTASLEFNPRYAKAYYRRARAHEATKDMN 180
            |...|:.     |:. |.|||.::..|||:.:...||.|.|:.:|...||:.|.|.||.|.   .
  Fly   256 IIYDPEN-----AVHAYNNRAVAHLKLKKYFSAISDCQACLQIDPMNIKAHLRMAEAHNAE---G 312

  Fly   181 ECLDDVTATCILEMFQNNQTIMFADRVLKETGRLDAEKGMRNRVPVVPSACFVNTYTRSFI--AD 243
            :.|:.:.....|..|:.:..|     ..|...:|.:..|     .|.||:.     ||..|  .|
  Fly   313 KHLESLNVYKKLLDFEPDNAI-----AKKAVEKLTSMLG-----EVAPSSA-----TRLIIEEID 362

  Fly   244 PLQTMKVPAPKSDAPPKGFLRAHLAFLEEKYEEIIPACTEEIESSE 289
            |.| :|...||.:|              ||.|..:....|.:.|::
  Fly   363 PPQ-LKTSEPKKEA--------------EKSEPTVVKKPEPVVSAK 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tom70NP_609536.1 TPR_11 89..160 CDD:290150 21/74 (28%)
TPR repeat 90..118 CDD:276809 7/27 (26%)
TPR repeat 123..158 CDD:276809 12/35 (34%)
TPR repeat 296..324 CDD:276809
TPR_11 333..399 CDD:290150
TPR repeat 334..362 CDD:276809
TPR repeat 367..397 CDD:276809
TPR repeat 402..437 CDD:276809
TPR_16 413..477 CDD:290168
TPR repeat 443..471 CDD:276809
TPR repeat 476..507 CDD:276809
TPR_11 486..539 CDD:290150
TPR repeat 512..539 CDD:276809
Spag1NP_651514.1 TPR_11 229..295 CDD:290150 21/70 (30%)
TPR repeat 229..257 CDD:276809 7/27 (26%)
TPR repeat 262..293 CDD:276809 12/35 (34%)
TPR_11 266..329 CDD:290150 22/65 (34%)
TPR 266..297 CDD:197478 12/30 (40%)
TPR repeat 298..326 CDD:276809 9/30 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462422
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1535
SonicParanoid 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.