DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tom70 and CG14894

DIOPT Version :9

Sequence 1:NP_609536.1 Gene:Tom70 / 34618 FlyBaseID:FBgn0032397 Length:589 Species:Drosophila melanogaster
Sequence 2:NP_001262636.1 Gene:CG14894 / 41993 FlyBaseID:FBgn0038428 Length:263 Species:Drosophila melanogaster


Alignment Length:152 Identity:48/152 - (31%)
Similarity:74/152 - (48%) Gaps:21/152 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 IEKQ-AISLDG---------------TAPDQEL---ERNQKSAELG-EKLSPLKE-ANNYKTEGN 98
            :||| .::||.               |..|.||   |..::..:|. |:|:..|| |:..|.|||
  Fly    38 VEKQNQLALDDEAEQGAAGGDSIATPTTVDSELTIEELREREKDLSPEQLTANKEKADKLKVEGN 102

  Fly    99 NCYRNGKYDEAIKFYDKAIDKCPKEHRTDMAIFYQNRAASYEMLKKWSNVKEDCTASLEFNPRYA 163
            ..::|...:.|.|.|.:|:|.||.....:.|:.|.||||:...|:......:|||.::|..|.|.
  Fly   103 ELFKNDDAEGAAKTYTEALDICPSASSKERAVLYGNRAAAKIKLEANKAAIDDCTKAIELWPEYV 167

  Fly   164 KAYYRRARAHEATKDMNECLDD 185
            :...|||:.:|.....:|.|:|
  Fly   168 RVLLRRAKLYEQEDKPDEALED 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tom70NP_609536.1 TPR_11 89..160 CDD:290150 25/71 (35%)
TPR repeat 90..118 CDD:276809 10/27 (37%)
TPR repeat 123..158 CDD:276809 10/34 (29%)
TPR repeat 296..324 CDD:276809
TPR_11 333..399 CDD:290150
TPR repeat 334..362 CDD:276809
TPR repeat 367..397 CDD:276809
TPR repeat 402..437 CDD:276809
TPR_16 413..477 CDD:290168
TPR repeat 443..471 CDD:276809
TPR repeat 476..507 CDD:276809
TPR_11 486..539 CDD:290150
TPR repeat 512..539 CDD:276809
CG14894NP_001262636.1 TPR_11 93..164 CDD:290150 24/70 (34%)
TPR repeat 94..122 CDD:276809 10/27 (37%)
TPR_11 132..198 CDD:290150 20/58 (34%)
TPR repeat 132..162 CDD:276809 10/29 (34%)
TPR_1 133..166 CDD:278916 12/32 (38%)
TPR 167..198 CDD:197478 7/23 (30%)
TPR repeat 167..195 CDD:276809 7/23 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462425
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D594913at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.