DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tom70 and Dpit47

DIOPT Version :9

Sequence 1:NP_609536.1 Gene:Tom70 / 34618 FlyBaseID:FBgn0032397 Length:589 Species:Drosophila melanogaster
Sequence 2:NP_001260729.1 Gene:Dpit47 / 35565 FlyBaseID:FBgn0266518 Length:396 Species:Drosophila melanogaster


Alignment Length:233 Identity:55/233 - (23%)
Similarity:103/233 - (44%) Gaps:64/233 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 AVKSWTAASK---------ELDG-----EKKRPKAKIEKQAISLDGTAPD---QELERN----QK 76
            |.|:||...:         |||.     ||||.:          :|...|   :|::::    ::
  Fly     6 AQKAWTDEERLELAAQLDAELDAFIDGLEKKRYE----------EGWPEDRWQEEMDKHPFFMKR 60

  Fly    77 SAELGEKLSPLKE-----------------ANNYKTEGNNCYRNGKYDEAIKFYDKAIDKCPKEH 124
            :.:.|:.:.|:.|                 |.|||.:||...::.|:..||..:.:.| |...::
  Fly    61 APQPGDDVHPMFEGLQKLKYDPEENTRDELALNYKEDGNFYMKHKKFRMAIYSFTEGI-KTKTDN 124

  Fly   125 RTDMAIFYQNRAASYEMLKKWSNVKEDCTASLEFNPRYAKAYYRRAR-AHEATKDMNECLDDVTA 188
            ...:|:.|.||:|::..:|.:.:...|...:|.:.|.|.||.:|.|: |:|.     |..|..|.
  Fly   125 PDVLAVLYNNRSAAHFFIKNYRSSLSDAQRALFYKPDYTKARWRSAQCAYEL-----ERFDLCTQ 184

  Fly   189 TC--ILEMFQNNQ---TIMFADRVLKETGRLDAEKGMR 221
            .|  :||:..:|:   .::..:::.|    |:.|:..|
  Fly   185 MCEELLEVDVDNEVAIALLHKNKMKK----LEIERNQR 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tom70NP_609536.1 TPR_11 89..160 CDD:290150 20/87 (23%)
TPR repeat 90..118 CDD:276809 9/27 (33%)
TPR repeat 123..158 CDD:276809 8/34 (24%)
TPR repeat 296..324 CDD:276809
TPR_11 333..399 CDD:290150
TPR repeat 334..362 CDD:276809
TPR repeat 367..397 CDD:276809
TPR repeat 402..437 CDD:276809
TPR_16 413..477 CDD:290168
TPR repeat 443..471 CDD:276809
TPR repeat 476..507 CDD:276809
TPR_11 486..539 CDD:290150
TPR repeat 512..539 CDD:276809
Dpit47NP_001260729.1 3a0801s09 84..>179 CDD:273380 28/100 (28%)
TPR repeat 91..119 CDD:276809 10/28 (36%)
TPR repeat 124..158 CDD:276809 8/33 (24%)
TPR repeat 163..191 CDD:276809 10/32 (31%)
TPR repeat 197..227 CDD:276809 4/26 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462420
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.