Sequence 1: | NP_609536.1 | Gene: | Tom70 / 34618 | FlyBaseID: | FBgn0032397 | Length: | 589 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001246058.1 | Gene: | Sgt / 35052 | FlyBaseID: | FBgn0032640 | Length: | 331 | Species: | Drosophila melanogaster |
Alignment Length: | 226 | Identity: | 62/226 - (27%) |
---|---|---|---|
Similarity: | 91/226 - (40%) | Gaps: | 58/226 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 33 AVKSWTAASKELDGEKKRPKAKIEKQAI---SLDGTAPDQE------------------------ 70
Fly 71 ------LERNQKSAELGEKLSPLKEANNYKTEGNNCYRNGKYDEAIKFYDKAIDKCPKEHRTDMA 129
Fly 130 IFYQNRAASYEMLKKWSNVKEDCTASLEFNPRYAKAYYRRARAHEATKDMNECLDDVTATCILEM 194
Fly 195 FQNNQTIMFADRVLKETGRLDAEKGMRNRVP 225 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Tom70 | NP_609536.1 | TPR_11 | 89..160 | CDD:290150 | 24/70 (34%) |
TPR repeat | 90..118 | CDD:276809 | 10/27 (37%) | ||
TPR repeat | 123..158 | CDD:276809 | 11/34 (32%) | ||
TPR repeat | 296..324 | CDD:276809 | |||
TPR_11 | 333..399 | CDD:290150 | |||
TPR repeat | 334..362 | CDD:276809 | |||
TPR repeat | 367..397 | CDD:276809 | |||
TPR repeat | 402..437 | CDD:276809 | |||
TPR_16 | 413..477 | CDD:290168 | |||
TPR repeat | 443..471 | CDD:276809 | |||
TPR repeat | 476..507 | CDD:276809 | |||
TPR_11 | 486..539 | CDD:290150 | |||
TPR repeat | 512..539 | CDD:276809 | |||
Sgt | NP_001246058.1 | SGTA_dimer | 9..>48 | CDD:293154 | 3/12 (25%) |
TPR_11 | 116..177 | CDD:290150 | 24/74 (32%) | ||
TPR_2 | 116..149 | CDD:285020 | 13/41 (32%) | ||
TPR repeat | 116..144 | CDD:276809 | 11/36 (31%) | ||
TPR_17 | 139..170 | CDD:290167 | 13/35 (37%) | ||
TPR repeat | 149..179 | CDD:276809 | 11/34 (32%) | ||
TPR_16 | 156..218 | CDD:290168 | 18/63 (29%) | ||
TPR_1 | 184..217 | CDD:278916 | 9/34 (26%) | ||
TPR repeat | 184..212 | CDD:276809 | 8/29 (28%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45462409 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |