DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tom70 and Sgt

DIOPT Version :9

Sequence 1:NP_609536.1 Gene:Tom70 / 34618 FlyBaseID:FBgn0032397 Length:589 Species:Drosophila melanogaster
Sequence 2:NP_001246058.1 Gene:Sgt / 35052 FlyBaseID:FBgn0032640 Length:331 Species:Drosophila melanogaster


Alignment Length:226 Identity:62/226 - (27%)
Similarity:91/226 - (40%) Gaps:58/226 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 AVKSWTAASKELDGEKKRPKAKIEKQAI---SLDGTAPDQE------------------------ 70
            |::...||....|..:..|.|..|:||.   |...:|||.:                        
  Fly    35 AIQCLQAAFDLGDDVEAAPAAAGEEQATTQSSSTASAPDDDAVASGSAGIGAAAAAVPNNIDMFE 99

  Fly    71 ------LERNQKSAELGEKLSPLKEANNYKTEGNNCYRNGKYDEAIKFYDKAIDKCPKEHRTDMA 129
                  .|||.:|..|.|.:         |.|||...:..||:||:..|::||...||.     .
  Fly   100 LFQSLYTERNPESLALAESI---------KNEGNRLMKENKYNEALLQYNRAIAFDPKN-----P 150

  Fly   130 IFYQNRAASYEMLKKWSNVKEDCTASLEFNPRYAKAYYRRARAHEATKDMNECLDDVTATCILEM 194
            |||.||||::..|.:......||.::|.:|..|:|||.|...|:....:. |..:...|..| |:
  Fly   151 IFYCNRAAAHIRLGENERAVTDCKSALVYNNNYSKAYCRLGVAYSNMGNF-EKAEQAYAKAI-EL 213

  Fly   195 FQNNQTIMFADRVLKETGRLDAEKGMRNRVP 225
            ..:|:       |.|  ..|:|.:..||:.|
  Fly   214 EPDNE-------VYK--SNLEAARNARNQPP 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tom70NP_609536.1 TPR_11 89..160 CDD:290150 24/70 (34%)
TPR repeat 90..118 CDD:276809 10/27 (37%)
TPR repeat 123..158 CDD:276809 11/34 (32%)
TPR repeat 296..324 CDD:276809
TPR_11 333..399 CDD:290150
TPR repeat 334..362 CDD:276809
TPR repeat 367..397 CDD:276809
TPR repeat 402..437 CDD:276809
TPR_16 413..477 CDD:290168
TPR repeat 443..471 CDD:276809
TPR repeat 476..507 CDD:276809
TPR_11 486..539 CDD:290150
TPR repeat 512..539 CDD:276809
SgtNP_001246058.1 SGTA_dimer 9..>48 CDD:293154 3/12 (25%)
TPR_11 116..177 CDD:290150 24/74 (32%)
TPR_2 116..149 CDD:285020 13/41 (32%)
TPR repeat 116..144 CDD:276809 11/36 (31%)
TPR_17 139..170 CDD:290167 13/35 (37%)
TPR repeat 149..179 CDD:276809 11/34 (32%)
TPR_16 156..218 CDD:290168 18/63 (29%)
TPR_1 184..217 CDD:278916 9/34 (26%)
TPR repeat 184..212 CDD:276809 8/29 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462409
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.