DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tom70 and STUB1

DIOPT Version :9

Sequence 1:NP_609536.1 Gene:Tom70 / 34618 FlyBaseID:FBgn0032397 Length:589 Species:Drosophila melanogaster
Sequence 2:NP_477441.1 Gene:STUB1 / 34433 FlyBaseID:FBgn0027052 Length:289 Species:Drosophila melanogaster


Alignment Length:240 Identity:50/240 - (20%)
Similarity:87/240 - (36%) Gaps:61/240 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 KTEGNNCYRNGKYDEAIKFYDKAIDKCPKEHRTDMAIFYQNRAASYEMLKKWSNVKEDCTASLEF 158
            |.:||..:...|||:||..|.|||.|.|..     |.::.|||.....||:|....:|...:|:.
  Fly    18 KEQGNCLFAARKYDDAINCYSKAIIKNPTN-----ATYFTNRALCNLKLKRWELCCQDSRRALDI 77

  Fly   159 NPRYAKAYY-----------------RRARAHEATKDMNECL-DDVTATCILEMFQNNQTIMFAD 205
            :....|.::                 ...||::.:|:..:.. ||:|....|.. :....:|...
  Fly    78 DGNLLKGHFFLGQGLMEIDNFDEAIKHLQRAYDLSKEQKQNFGDDITLQLRLAR-KKRWNVMEEK 141

  Fly   206 RVLKETGRLDAEKGMRNRVPVVPSACFVNTYTRSFIADPLQTMKVPAPKSDAPPKGFLRAHLAFL 270
            |:.:|                :....::|...:..:...|..:|:..           ..|...|
  Fly   142 RIQQE----------------IELQSYLNGLIKGDMESRLANLKLNG-----------NVHDEQL 179

  Fly   271 EEKYEEIIPACTEEIES-----SEAEAQYKVEALLMRGTFHLLCG 310
            ::|.:||...|.:.|:.     |:.:.:.|     .|.....|||
  Fly   180 KDKQQEIEQECDDHIKELNNIFSKVDERRK-----KREVPDFLCG 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tom70NP_609536.1 TPR_11 89..160 CDD:290150 23/65 (35%)
TPR repeat 90..118 CDD:276809 11/23 (48%)
TPR repeat 123..158 CDD:276809 9/34 (26%)
TPR repeat 296..324 CDD:276809 4/15 (27%)
TPR_11 333..399 CDD:290150
TPR repeat 334..362 CDD:276809
TPR repeat 367..397 CDD:276809
TPR repeat 402..437 CDD:276809
TPR_16 413..477 CDD:290168
TPR repeat 443..471 CDD:276809
TPR repeat 476..507 CDD:276809
TPR_11 486..539 CDD:290150
TPR repeat 512..539 CDD:276809
STUB1NP_477441.1 TPR_11 17..78 CDD:290150 23/64 (36%)
TPR 17..47 CDD:197478 14/28 (50%)
TPR repeat 17..42 CDD:276809 11/23 (48%)
TPR repeat 47..77 CDD:276809 9/34 (26%)
TPR repeat 82..110 CDD:276809 3/27 (11%)
U-box 213..285 CDD:252675 3/7 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462421
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.