DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Tom70 and aip

DIOPT Version :9

Sequence 1:	NP_609536.1	Gene:	Tom70 / 34618	FlyBaseID:	FBgn0032397	Length:	589	Species:	Drosophila melanogaster
Sequence 2:	NP_999877.1	Gene:	aip / 334795	ZFINID:	ZDB-GENE-030131-6735	Length:	342	Species:	Danio rerio

Alignment Length:	130	Identity:	39/130 - (30%)
Similarity:	54/130 - (41%)	Gaps:	19/130 - (14%)

- Green bases have known domain annotations that are detailed below.

  Fly   272 EKYEEIIPACTEEIESSEA---EAQYKVE-----ALLMRGTFHLLCGSYVESQQDFDAIIANDYA 328
            |||...| ||.:.::..|.   |...|::     .||......||.|.|.|......:|| |.|.
Zfish   201 EKYYNAI-ACLKSLQMKERPGDEHWIKLDLMITPLLLNYCQCKLLLGQYYEVLDHCSSII-NKYE 263

  Fly   329 DPNLRAYAYIKRAALYIQLDQREKGIADFAEAERLNPENPDVYHQRAQILLLLEQIEPALAEFEK 393
            | |::  ||.||...:..:....:..||||:...|:|.      ..|.|...|..:|..:.|.||
Zfish   264 D-NVK--AYFKRGKAHAAVWNEAEARADFAKVLTLDPS------LEASIAKELRAMEERIREKEK 319

Fly 394 393
Zfish 320 319

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Tom70	NP_609536.1	TPR_11	89..160	CDD:290150
		TPR repeat	90..118	CDD:276809
		TPR repeat	123..158	CDD:276809
		TPR repeat	296..324	CDD:276809	8/32 (25%)
		TPR_11	333..399	CDD:290150	17/61 (28%)
		TPR repeat	334..362	CDD:276809	8/27 (30%)
		TPR repeat	367..397	CDD:276809	7/27 (26%)
		TPR repeat	402..437	CDD:276809
		TPR_16	413..477	CDD:290168
		TPR repeat	443..471	CDD:276809
		TPR repeat	476..507	CDD:276809
		TPR_11	486..539	CDD:290150
		TPR repeat	512..539	CDD:276809
aip	NP_999877.1	FKBP_C	30..>91	CDD:278674
		TPR repeat	184..226	CDD:276809	8/25 (32%)
		TPR repeat	231..261	CDD:276809	9/30 (30%)
		TPR_11	<245..297	CDD:290150	18/55 (33%)
		TPR repeat	266..293	CDD:276809	8/28 (29%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R1535
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	1.030