Sequence 1: | NP_609536.1 | Gene: | Tom70 / 34618 | FlyBaseID: | FBgn0032397 | Length: | 589 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001014719.2 | Gene: | HIP-R / 31335 | FlyBaseID: | FBgn0029676 | Length: | 377 | Species: | Drosophila melanogaster |
Alignment Length: | 280 | Identity: | 61/280 - (21%) |
---|---|---|---|
Similarity: | 100/280 - (35%) | Gaps: | 75/280 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MAMTLNIGSMKLTKWQLALILGTPLAIGL----------------------------------GT 31
Fly 32 YAVKSWTAASKELDGEKKR----PKAKIEKQAISLDG-----TAPDQELERNQKSAELGEKLSPL 87
Fly 88 KEANNYKTEGNNCYRNGKYDEAIKFYDKAIDKCPKEHRTDMAIFYQNRAASYEMLKKWSNVKEDC 152
Fly 153 TASLEFNPRYAKAYYRRARAHEATKDMNECLDDVTATCILEMFQNNQTIMFADRVLKET------ 211
Fly 212 --------GRLDAEKGMRNR 223 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Tom70 | NP_609536.1 | TPR_11 | 89..160 | CDD:290150 | 22/70 (31%) |
TPR repeat | 90..118 | CDD:276809 | 10/27 (37%) | ||
TPR repeat | 123..158 | CDD:276809 | 9/34 (26%) | ||
TPR repeat | 296..324 | CDD:276809 | |||
TPR_11 | 333..399 | CDD:290150 | |||
TPR repeat | 334..362 | CDD:276809 | |||
TPR repeat | 367..397 | CDD:276809 | |||
TPR repeat | 402..437 | CDD:276809 | |||
TPR_16 | 413..477 | CDD:290168 | |||
TPR repeat | 443..471 | CDD:276809 | |||
TPR repeat | 476..507 | CDD:276809 | |||
TPR_11 | 486..539 | CDD:290150 | |||
TPR repeat | 512..539 | CDD:276809 | |||
HIP-R | NP_001014719.2 | Hip_N | 10..47 | CDD:271228 | 4/36 (11%) |
TPR_11 | 125..190 | CDD:290150 | 22/69 (32%) | ||
TPR_2 | 126..159 | CDD:285020 | 12/32 (38%) | ||
TPR repeat | 126..154 | CDD:276809 | 10/27 (37%) | ||
TPR repeat | 159..189 | CDD:276809 | 9/34 (26%) | ||
TPR repeat | 194..222 | CDD:276809 | 7/27 (26%) | ||
STI1 | 299..336 | CDD:128966 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45462423 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |