DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tom70 and aipr-1

DIOPT Version :9

Sequence 1:NP_609536.1 Gene:Tom70 / 34618 FlyBaseID:FBgn0032397 Length:589 Species:Drosophila melanogaster
Sequence 2:NP_495339.1 Gene:aipr-1 / 174092 WormBaseID:WBGene00016966 Length:342 Species:Caenorhabditis elegans


Alignment Length:221 Identity:50/221 - (22%)
Similarity:80/221 - (36%) Gaps:50/221 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KELDGEKKRPKAKIEKQAISLDGTAPDQ------ELERNQKSAELGEKLSPLKEANNYKTEGNNC 100
            :|||...|.|: .:......|....|||      :|:.:.|          ||.....:.:||..
 Worm   148 EELDELMKNPR-PLRFVFHLLQVFEPDQYVHDSWQLDEDDK----------LKSVEALRQKGNEL 201

  Fly   101 YRNGKYDEAIKFYDKAIDKC--------PKE------HRTDMAIFYQNRAASYEMLKKWSNVKED 151
            :....|.|||..|..|:.:.        |.|      .|.::.: |.|.:..|..:......:|.
 Worm   202 FVQKDYKEAIDAYRDALTRLDTLILREKPGEPEWVELDRKNIPL-YANMSQCYLNIGDLHEAEET 265

  Fly   152 CTASLEFNPRYAKAYYRRARAHEATKDMNECLDDVTATCILEMFQNNQ--TIMFADRVLKETGRL 214
            .:..|:......||.:|||:|..|...::|..:|      |::...|.  ......|.:|.....
 Worm   266 SSEVLKREETNEKALFRRAKARIAAWKLDEAEED------LKLLLRNHPAAASVVAREMKIVTER 324

  Fly   215 DAEKGMRNRVPVVPSACFVNTYTRSF 240
            .|||...:||          ||::.|
 Worm   325 RAEKKADSRV----------TYSKMF 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tom70NP_609536.1 TPR_11 89..160 CDD:290150 16/84 (19%)
TPR repeat 90..118 CDD:276809 8/27 (30%)
TPR repeat 123..158 CDD:276809 7/40 (18%)
TPR repeat 296..324 CDD:276809
TPR_11 333..399 CDD:290150
TPR repeat 334..362 CDD:276809
TPR repeat 367..397 CDD:276809
TPR repeat 402..437 CDD:276809
TPR_16 413..477 CDD:290168
TPR repeat 443..471 CDD:276809
TPR repeat 476..507 CDD:276809
TPR_11 486..539 CDD:290150
TPR repeat 512..539 CDD:276809
aipr-1NP_495339.1 TPR repeat 191..237 CDD:276809 10/45 (22%)
TPR_1 191..>218 CDD:278916 7/26 (27%)
TPR_11 192..271 CDD:290150 15/79 (19%)
TPR repeat 242..272 CDD:276809 5/30 (17%)
TPR_11 245..308 CDD:290150 16/69 (23%)
TPR repeat 277..305 CDD:276809 10/33 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1535
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.