DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Tom70 and ttc-1

DIOPT Version :9

Sequence 1:	NP_609536.1	Gene:	Tom70 / 34618	FlyBaseID:	FBgn0032397	Length:	589	Species:	Drosophila melanogaster
Sequence 2:	NP_492795.1	Gene:	ttc-1 / 172965	WormBaseID:	WBGene00016390	Length:	207	Species:	Caenorhabditis elegans

Alignment Length:	143	Identity:	42/143 - (29%)
Similarity:	62/143 - (43%)	Gaps:	17/143 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly    87 LKEANNYKTEGNNCYRNGKYDEAIKFYDKAIDKCPKEHRTDMAIFYQNRAASYEMLKKWSNVKED 151
            :.:.::.|.||||.:.||::::|.:.|.:||..||.......:|...|.||:...|:||.:..|.
Worm    15 ITKVDSLKKEGNNFFANGEFEKANEKYQEAIASCPPTSTEVQSILLSNSAAALIKLRKWESAVEA 79

  Fly   152 CTASLEFNPRYAKAYYRRARAH-----------EATKDMNECLD------DVTATCILEMFQNNQ 199
            .:.|:|......||..|||.|:           |..|.:.|.|.      |.....|.|...|..
Worm    80 ASKSIEIGATNEKALERRAFAYSNMSEKYENSIEDYKQLQESLPKRRVELDRKIAEINEKINNRN 144

  Fly   200 TIMFADRVLKETG 212
            ..|.||.:.|..|
Worm   145 EAMKADVMEKLKG 157

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Tom70	NP_609536.1	TPR_11	89..160	CDD:290150	23/70 (33%)
		TPR repeat	90..118	CDD:276809	10/27 (37%)
		TPR repeat	123..158	CDD:276809	9/34 (26%)
		TPR repeat	296..324	CDD:276809
		TPR_11	333..399	CDD:290150
		TPR repeat	334..362	CDD:276809
		TPR repeat	367..397	CDD:276809
		TPR repeat	402..437	CDD:276809
		TPR_16	413..477	CDD:290168
		TPR repeat	443..471	CDD:276809
		TPR repeat	476..507	CDD:276809
		TPR_11	486..539	CDD:290150
		TPR repeat	512..539	CDD:276809
ttc-1	NP_492795.1	TPR repeat	18..46	CDD:276809	10/27 (37%)
		3a0801s09	<20..>115	CDD:273380	30/94 (32%)
		TPR repeat	56..86	CDD:276809	9/29 (31%)
		TPR repeat	91..120	CDD:276809	8/28 (29%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D594913at33208
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	3	2.920