DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tom70 and ttc1

DIOPT Version :9

Sequence 1:NP_609536.1 Gene:Tom70 / 34618 FlyBaseID:FBgn0032397 Length:589 Species:Drosophila melanogaster
Sequence 2:XP_002940222.1 Gene:ttc1 / 100487316 XenbaseID:XB-GENE-994101 Length:241 Species:Xenopus tropicalis


Alignment Length:129 Identity:44/129 - (34%)
Similarity:70/129 - (54%) Gaps:14/129 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 APDQELERNQKSAELGEKLSPLKEANNYKTEGNNCYRNGKYDEAIKFYDKAIDKCPKEHRTDMAI 130
            |.:.|.||.:|.          |::...|.|||..::||:|..|...|.:|:..||..:..|:||
 Frog    51 ATESEEEREEKR----------KQSTTLKEEGNQLFKNGEYPAAETVYTQALQTCPAFYSQDLAI 105

  Fly   131 FYQNRAASYEMLKKWSNVK-EDCTASLEFNPRYAKAYYRRARAHEATKDMNECLDDVTATCILE 193
            .:.||||: .|.:..:::. |||:.::|.||.|.:|..|||..:|.|..::|.|.|..:  :||
 Frog   106 LFSNRAAA-RMRQNMNDLALEDCSKAIELNPDYIRALLRRAELYEKTDKLDEALADYKS--VLE 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tom70NP_609536.1 TPR_11 89..160 CDD:290150 24/71 (34%)
TPR repeat 90..118 CDD:276809 10/27 (37%)
TPR repeat 123..158 CDD:276809 11/35 (31%)
TPR repeat 296..324 CDD:276809
TPR_11 333..399 CDD:290150
TPR repeat 334..362 CDD:276809
TPR repeat 367..397 CDD:276809
TPR repeat 402..437 CDD:276809
TPR_16 413..477 CDD:290168
TPR repeat 443..471 CDD:276809
TPR repeat 476..507 CDD:276809
TPR_11 486..539 CDD:290150
TPR repeat 512..539 CDD:276809
ttc1XP_002940222.1 TPR repeat 67..93 CDD:276809 10/25 (40%)
3a0801s09 <68..>161 CDD:273380 35/93 (38%)
TPR repeat 103..133 CDD:276809 10/30 (33%)
BTAD <137..>190 CDD:198111 12/32 (38%)
TPR repeat 138..166 CDD:276809 9/29 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D594913at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.