DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tom70 and ttc6

DIOPT Version :9

Sequence 1:NP_609536.1 Gene:Tom70 / 34618 FlyBaseID:FBgn0032397 Length:589 Species:Drosophila melanogaster
Sequence 2:XP_031747339.1 Gene:ttc6 / 100485775 XenbaseID:XB-GENE-952850 Length:1927 Species:Xenopus tropicalis


Alignment Length:748 Identity:139/748 - (18%)
Similarity:226/748 - (30%) Gaps:306/748 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 GKYDEAIKFYDK--AIDK-CPKEHRTDMAIFYQNRAASYEMLKKWSNVKEDCTASLEFNPRYAKA 165
            |.:.|||..:::  |:|: ....|.....|...||       |.::......||:|..:|.|.||
 Frog  1214 GLWAEAICDFERVLALDRTVVLAHMNLGLISLLNR-------KDYAQAIRHFTAALNVDPVYIKA 1271

  Fly   166 YYRRARAHEATKDMNECLDDVT-----------------------------ATCI---LEMFQNN 198
            |..||:|.:...|:|..:.|:|                             :.||   .||.|.:
 Frog  1272 YLCRAQAFQQINDLNNAMKDITRAIHLHPDSPQPYLIRGQYLYEMKKYSLASFCINYAAEMTQGS 1336

  Fly   199 Q---------------------------------TIMFADRVLKETGRLDAEKGMRNRVPVVPSA 230
            .                                 .|:.....:|.....||.|..|:.:.:..|:
 Frog  1337 SAAQQALVQSFRQQYSNAIECLVSAIQAKPAPALVILLGKIQMKANNSKDAVKTFRDALDMFKSS 1401

  Fly   231 -------------------CFVNTYTRSFIADPL-QTMKVPAPKSDA-PPKGFLRAHL------- 267
                               |::..:......:.| ..:||.:...:| ..:|..|.||       
 Frog  1402 NDLILSPSNKAEILFNLGLCYMEQFDFQKALEALTSAIKVRSRFHEAYYQRGLCRMHLQQAKCLD 1466

  Fly   268 --------------AFL--------EEKYEEIIPACTEEIESSEAEAQYKVEALLMRGTFHLLCG 310
                          |.|        .::|.:.|..|...|:..    .:.|.|.|.||.......
 Frog  1467 DFNKALEINPNYFQALLCRATFYGFRKRYSKAIMNCNAAIKVQ----PHSVRAYLYRGALKYYIK 1527

  Fly   311 SYVESQQDFDAIIAND------------------YADPNLRAYA---------------YIKRAA 342
            :|..:.|||......|                  ..|..|:.|:               .:.|..
 Frog  1528 AYKLAVQDFSKAATLDPTCSLVYYNRGVCHHQTKMYDEALKDYSIVLLLGGWKEVDSKVLVNRGL 1592

  Fly   343 LYIQLDQREKGIADFAEAERLNPENPDVY------HQRAQILLLLEQIEPALAEFEKAVSIAPNH 401
            ||::|......:.||.......|.:..::      |||      |:|.|.|:..|.:|::|.|..
 Frog  1593 LYLELQDFANALEDFKCVALRTPGDIKIHLVIGNCHQR------LQQYEEAVQAFNQALNITPLS 1651

  Fly   402 AIAFVQK--CYAEYRLSLLAGDQRRLESVMHTFQNAIERFPSCVEC-----YSLTAQ-------- 451
            |.|.:.:  .|.||      |.||........|..|:...||||..     |:|.||        
 Frog  1652 AEACIGRGNAYIEY------GHQRGTAQAKRDFLRALHLSPSCVAARICLGYTLQAQGLFQQAWN 1710

  Fly   452 ----------------------------------------------------------------- 451
                                                                             
 Frog  1711 HFTVALDIDPQSILGFEGRAIVSLQIGDTFAALQDMNAALKLCGSAQLLTNRGVIHQFMGKLPNA 1775

  Fly   452 -------VLADQ----------------QQFTQAEEYYKKAMVLAPTNPALIVHQAI--MVLQWR 491
                   :.|||                :|||||:|||.:|:.|.|.|.:.::::.|  |:||  
 Frog  1776 MRDYQAAITADQDYSLAYFNAANLYLHNRQFTQAKEYYTRAVALDPANESAVLNRGITNMLLQ-- 1838

  Fly   492 GDINLAVQLLNKAIEVDPKCELA-------YETLGTVEVQRAQLTRAVELFEKALLYAKSQAELV 549
             |...|:......:.:.|....|       |.||...:...:.:::|:.|          |.:..
 Frog  1839 -DAQAALHDFQLVLSLCPVSSAAYFNRASLYNTLQQYQWAESDISQALNL----------QPDDP 1892

  Fly   550 HVYSLRNAAVAQINVTKKLGIDM-NSVSAMAQS 581
            .:|.||.....::.:||:...|. ::::.:.||
 Frog  1893 LIYKLRADIRGKLGLTKEAIEDYEHAITLLGQS 1925

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tom70NP_609536.1 TPR_11 89..160 CDD:290150 14/58 (24%)
TPR repeat 90..118 CDD:276809 5/15 (33%)
TPR repeat 123..158 CDD:276809 8/34 (24%)
TPR repeat 296..324 CDD:276809 9/27 (33%)
TPR_11 333..399 CDD:290150 18/86 (21%)
TPR repeat 334..362 CDD:276809 7/42 (17%)
TPR repeat 367..397 CDD:276809 9/35 (26%)
TPR repeat 402..437 CDD:276809 10/36 (28%)
TPR_16 413..477 CDD:290168 28/164 (17%)
TPR repeat 443..471 CDD:276809 17/128 (13%)
TPR repeat 476..507 CDD:276809 7/32 (22%)
TPR_11 486..539 CDD:290150 12/59 (20%)
TPR repeat 512..539 CDD:276809 6/33 (18%)
ttc6XP_031747339.1 TPR repeat 964..989 CDD:276809
TPR <966..1157 CDD:223533
TPR repeat 1028..1058 CDD:276809
TPR repeat 1063..1091 CDD:276809
TPR repeat 1097..1123 CDD:276809
PEP_TPR_lipo 1112..1829 CDD:274350 117/637 (18%)
TPR repeat 1131..1159 CDD:276809
TPR repeat 1164..1229 CDD:276809 4/14 (29%)
TPR repeat 1236..1263 CDD:276809 7/33 (21%)
TPR repeat 1268..1298 CDD:276809 11/29 (38%)
TPR repeat 1303..1331 CDD:276809 2/27 (7%)
TPR repeat 1337..1363 CDD:276809 0/25 (0%)
TPR repeat 1372..1396 CDD:276809 6/23 (26%)
TPR repeat 1412..1440 CDD:276809 2/27 (7%)
TPR repeat 1445..1474 CDD:276809 5/28 (18%)
TPR repeat 1480..1507 CDD:276809 5/26 (19%)
TPR repeat 1512..1542 CDD:276809 9/29 (31%)
TPR repeat 1547..1574 CDD:276809 3/26 (12%)
TPR repeat 1583..1613 CDD:276809 6/29 (21%)
TPR repeat 1618..1645 CDD:276809 8/32 (25%)
TPR repeat 1652..1682 CDD:276809 9/35 (26%)
TPR repeat 1691..1717 CDD:276809 4/25 (16%)
TPR 1741..1927 CDD:223533 37/198 (19%)
TPR repeat 1756..1784 CDD:276809 0/27 (0%)
TPR repeat 1789..1819 CDD:276809 9/29 (31%)
TPR repeat 1824..1852 CDD:276809 6/30 (20%)
TPR repeat 1858..1885 CDD:276809 4/26 (15%)
TPR repeat 1892..1919 CDD:276809 6/26 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303136at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.