Sequence 1: | NP_609536.1 | Gene: | Tom70 / 34618 | FlyBaseID: | FBgn0032397 | Length: | 589 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001096219.1 | Gene: | aip / 100124770 | XenbaseID: | XB-GENE-947114 | Length: | 328 | Species: | Xenopus tropicalis |
Alignment Length: | 199 | Identity: | 44/199 - (22%) |
---|---|---|---|
Similarity: | 76/199 - (38%) | Gaps: | 53/199 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 67 PD-QELERNQKSAELGEKLSPLKEANNYK-------------------TEGNNCYRNGKYDEAIK 111
Fly 112 FYDKAIDKCPKEHR-----------------TDMAIFYQNRAASYEMLK-KWSNVKEDCTASLEF 158
Fly 159 NPRYAKAYYRRARAHEATKDMNECLDDVTATCILEMFQNNQTIMFADRVLKETGRLDA---EKGM 220
Fly 221 RNRV 224 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Tom70 | NP_609536.1 | TPR_11 | 89..160 | CDD:290150 | 21/107 (20%) |
TPR repeat | 90..118 | CDD:276809 | 10/46 (22%) | ||
TPR repeat | 123..158 | CDD:276809 | 7/52 (13%) | ||
TPR repeat | 296..324 | CDD:276809 | |||
TPR_11 | 333..399 | CDD:290150 | |||
TPR repeat | 334..362 | CDD:276809 | |||
TPR repeat | 367..397 | CDD:276809 | |||
TPR repeat | 402..437 | CDD:276809 | |||
TPR_16 | 413..477 | CDD:290168 | |||
TPR repeat | 443..471 | CDD:276809 | |||
TPR repeat | 476..507 | CDD:276809 | |||
TPR_11 | 486..539 | CDD:290150 | |||
TPR repeat | 512..539 | CDD:276809 | |||
aip | NP_001096219.1 | FKBP_C | 28..>89 | CDD:388582 | |
3a0801s09 | 169..>320 | CDD:273380 | 36/162 (22%) | ||
TPR repeat | 180..206 | CDD:276809 | 10/26 (38%) | ||
TPR repeat | 229..259 | CDD:276809 | 7/33 (21%) | ||
TPR repeat | 264..292 | CDD:276809 | 9/27 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1535 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.030 |