DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tom70 and aip

DIOPT Version :9

Sequence 1:NP_609536.1 Gene:Tom70 / 34618 FlyBaseID:FBgn0032397 Length:589 Species:Drosophila melanogaster
Sequence 2:NP_001096219.1 Gene:aip / 100124770 XenbaseID:XB-GENE-947114 Length:328 Species:Xenopus tropicalis


Alignment Length:199 Identity:44/199 - (22%)
Similarity:76/199 - (38%) Gaps:53/199 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PD-QELERNQKSAELGEKLSPLKEANNYK-------------------TEGNNCYRNGKYDEAIK 111
            || .||::|.:.......|..::|..:|:                   .|||..|:.||.::|..
 Frog   135 PDLDELQKNPQLLIFIITLLQVQEPGSYRQDAWAMTDQEKMEAVPVLHQEGNQLYKQGKTNDAAA 199

  Fly   112 FYDKAIDKCPKEHR-----------------TDMAIFYQNRAASYEMLK-KWSNVKEDCTASLEF 158
            .|.:|| .|.|..:                 |.:.:.|    ...::|: .:..|.|.|::.|..
 Frog   200 KYYEAI-ACLKSLQMKEQPGSPDWIALDLKITPLLLNY----CQCKLLEGDYYQVLEHCSSILNK 259

  Fly   159 NPRYAKAYYRRARAHEATKDMNECLDDVTATCILEMFQNNQTIMFADRVLKETGRLDA---EKGM 220
            .....||.::|.|||.|..:.:|...|.:....|:.       ..|..|.||..:|:.   ||.:
 Frog   260 YSDNVKALFKRGRAHAAVWNASEAERDFSRAVSLDP-------SLAPLVAKEMKKLEERLHEKNL 317

  Fly   221 RNRV 224
            .:::
 Frog   318 EDKI 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tom70NP_609536.1 TPR_11 89..160 CDD:290150 21/107 (20%)
TPR repeat 90..118 CDD:276809 10/46 (22%)
TPR repeat 123..158 CDD:276809 7/52 (13%)
TPR repeat 296..324 CDD:276809
TPR_11 333..399 CDD:290150
TPR repeat 334..362 CDD:276809
TPR repeat 367..397 CDD:276809
TPR repeat 402..437 CDD:276809
TPR_16 413..477 CDD:290168
TPR repeat 443..471 CDD:276809
TPR repeat 476..507 CDD:276809
TPR_11 486..539 CDD:290150
TPR repeat 512..539 CDD:276809
aipNP_001096219.1 FKBP_C 28..>89 CDD:388582
3a0801s09 169..>320 CDD:273380 36/162 (22%)
TPR repeat 180..206 CDD:276809 10/26 (38%)
TPR repeat 229..259 CDD:276809 7/33 (21%)
TPR repeat 264..292 CDD:276809 9/27 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1535
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.