DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdr81 and nbeab

DIOPT Version :9

Sequence 1:NP_609535.1 Gene:Wdr81 / 34616 FlyBaseID:FBgn0032395 Length:1953 Species:Drosophila melanogaster
Sequence 2:XP_009290096.1 Gene:nbeab / 565885 ZFINID:ZDB-GENE-120329-2 Length:2891 Species:Danio rerio


Alignment Length:405 Identity:112/405 - (27%)
Similarity:178/405 - (43%) Gaps:83/405 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 QILQLAKHLQGQGLFLGDLR--LQDIVLRENLWLQVLPRLQCNLL---DDDPAGEDMSPLTPLV- 307
            ::|..::.|.|:.:| .::|  .....|.:|..|::....:.:::   .|.|..:.:....|.| 
Zfish  2140 KVLVYSEGLHGKWMF-SEIRAVFTRRFLLQNTALEIFMANRTSVMFNFPDQPTVKKVVYSLPCVG 2203

  Fly   308 ---SEDLGEAREAQQALP----SSSTMFDLRFAYDPAHFNLREYTEMWCNGQLSNFDYLTILNNA 365
               |..|.:||....|.|    .||.|                 |:.|...::|||:||..||..
Zfish  2204 VGTSYGLPQARRISLASPRQLFKSSNM-----------------TQRWQRREISNFEYLMFLNTI 2251

  Fly   366 CGRSLTNAAYHHIMPWV-TDFSGRG-----GGAWRDLTKSKYRLNKGDVHLDLMYAHASQHGSAD 424
            .||:..:...:.:.||| |:|....     ...:|||:|....||....   :.||         
Zfish  2252 AGRTYNDLNQYPVFPWVLTNFESEELDLTVPSNFRDLSKPIGALNPKRA---VFYA--------- 2304

  Fly   425 GSYQAIGDQAP--HHVSDFLSEITYFVYMARRTPQS--ILCAHVRPIWVPAEYPVSIQR----LQ 481
            ..|::..::.|  |:.:.:.:..:...::.|..|.:  .|.|:......|.....||.|    .|
Zfish  2305 DRYESWDEETPPCHYTTHYSTANSTLHWLVRIEPFTTFFLNANGNKFDHPNRTFSSIARSWRHCQ 2369

  Fly   482 EWTPD--ECIPEFYSDPMIFKSIH--------EDLP--DLELPAWATCPEDFICKHREALESQYV 534
            ..|.|  |.|||||..|.:|.:.:        :.:|  |:||||||..||||:..:|.||||::|
Zfish  2370 RDTADVKELIPEFYYLPEMFVNSNGYCLGDRDDGVPVCDVELPAWAKKPEDFVRINRMALESEFV 2434

  Fly   535 SERLHHWIDLNFGYKLSGKAAVKSKNVCLTLVDQHRNLSQRGIVQLFA-SAHPPRRYATPWFSRT 598
            |.:||.||||.||||..|..|.::.||       ..:|:..|.|.|.: ::.||.|.|      |
Zfish  2435 SCQLHQWIDLIFGYKQRGPEAARALNV-------FHHLTYEGSVNLDSLASDPPLREA------T 2486

  Fly   599 APRLSQLYASPAKRL 613
            ..::..:..||::.|
Zfish  2487 EAQIQSVGQSPSQLL 2501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdr81NP_609535.1 Beach 345..588 CDD:100117 84/269 (31%)
WD40 <1644..1877 CDD:225201
WD40 1651..1876 CDD:295369
WD40 repeat 1662..1705 CDD:293791
WD40 repeat 1710..1744 CDD:293791
WD40 repeat 1752..1788 CDD:293791
WD40 repeat 1799..1836 CDD:293791
nbeabXP_009290096.1 LamG 247..394 CDD:304605
DUF4704 464..735 CDD:292415
DUF1088 1899..2077 CDD:284000
PH_BEACH 2103..2200 CDD:291510 10/60 (17%)
Beach 2232..2508 CDD:280327 90/295 (31%)
WD40 <2580..2879 CDD:225201
WD40 repeat 2626..2663 CDD:293791
WD40 2627..2879 CDD:295369
WD40 repeat 2669..2723 CDD:293791
WD40 repeat 2728..2763 CDD:293791
WD40 repeat 2767..2797 CDD:293791
WD40 repeat 2806..2846 CDD:293791
WD40 repeat 2852..2878 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.