DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdr81 and AgaP_AGAP012480

DIOPT Version :9

Sequence 1:NP_609535.1 Gene:Wdr81 / 34616 FlyBaseID:FBgn0032395 Length:1953 Species:Drosophila melanogaster
Sequence 2:XP_561540.3 Gene:AgaP_AGAP012480 / 3292239 VectorBaseID:AGAP012480 Length:234 Species:Anopheles gambiae


Alignment Length:240 Identity:68/240 - (28%)
Similarity:99/240 - (41%) Gaps:61/240 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   362 LNNACGRSLTNAAYHHIMPWV--------TDFSGRGGGAWRDLTK-----SKYRLNKGDVHLDLM 413
            ||:..|||..:...:.:.||:        .|.|....  :|||:|     ::.||.:        
Mosquito     3 LNSLAGRSYNDLMQYPVFPWILANYDSEFLDLSEPSN--FRDLSKPMGAQTQERLEQ-------- 57

  Fly   414 YAHASQHGSADGSYQAIGDQAPHHV-SDFLSEITYFVYMARRTP--QSILCAH------------ 463
              :..:....|...   ||..|:|. :.:.|.:....|:.|..|  |..|...            
Mosquito    58 --YLKRFKDWDDPQ---GDTPPYHYGTHYSSAMIVCSYLIRLEPFTQHFLRLQGGHFDLADRMFH 117

  Fly   464 -VRPIWVPAEYPVSIQRLQEWTPDECIPEFYSDPMIFKSIH----------EDLPDLELPAWA-T 516
             |:..|:.|    |.|.:.:  ..|.|||||..|...::.:          :.|..:.||.|| .
Mosquito   118 SVKEAWLSA----SRQNMAD--VKELIPEFYYLPEFLENSNRFDLGTKQNGDILNHIVLPPWAKN 176

  Fly   517 CPEDFICKHREALESQYVSERLHHWIDLNFGYKLSGKAAVKSKNV 561
            ...:||..||||||..|||..||.||||.||:|..|:||:.:.||
Mosquito   177 DHREFIRMHREALECDYVSRHLHLWIDLIFGHKQQGQAAIDAVNV 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdr81NP_609535.1 Beach 345..588 CDD:100117 68/240 (28%)
WD40 <1644..1877 CDD:225201
WD40 1651..1876 CDD:295369
WD40 repeat 1662..1705 CDD:293791
WD40 repeat 1710..1744 CDD:293791
WD40 repeat 1752..1788 CDD:293791
WD40 repeat 1799..1836 CDD:293791
AgaP_AGAP012480XP_561540.3 Beach 1..233 CDD:280327 68/240 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1786
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.