DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdr81 and Lyst

DIOPT Version :9

Sequence 1:NP_609535.1 Gene:Wdr81 / 34616 FlyBaseID:FBgn0032395 Length:1953 Species:Drosophila melanogaster
Sequence 2:XP_006516624.1 Gene:Lyst / 17101 MGIID:107448 Length:3839 Species:Mus musculus


Alignment Length:313 Identity:89/313 - (28%)
Similarity:137/313 - (43%) Gaps:75/313 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 NLREY------TEMWCNGQLSNFDYLTILNNACGRSLTNAAYHHIMPWV-TDFSG-----RGGGA 392
            ||.||      |.:|.:||::||:|||.||...|||..:...:.:.|:: :|:..     .....
Mouse  3159 NLLEYGNITALTNLWYSGQITNFEYLTHLNKHAGRSFNDLMQYPVFPFILSDYVSETLDLNDPSI 3223

  Fly   393 WRDLTKS---KYRLNKGDVHLDLMYAHASQH---GSADGSYQAIGDQAP-----HHVSDFLSEIT 446
            :|:|:|.   :|: .|.|.::| .|.:..:.   |:.:      .|..|     |:.|.:.:..|
Mouse  3224 YRNLSKPIAVQYK-EKEDRYVD-TYKYLEEEYRKGARE------DDPMPPVQPYHYGSHYSNSGT 3280

  Fly   447 YFVYMARRTP--QSILCAHVRPIWVPAEYPVSIQ---RLQEWTP----DECIPEFYSDPMIF--- 499
            ...::.|..|  :..|....:...:|.....|..   ||..:..    .|.||||:..|...   
Mouse  3281 VLHFLVRMPPFTKMFLAYQDQSFDIPDRTFHSTNTTWRLSSFESMTDVKELIPEFFYLPEFLVNR 3345

  Fly   500 -------KSIHEDLPDLELPAWA-TCPEDFICKHREALESQYVSERLHHWIDLNFGYKLSGKAAV 556
                   :...|.:..:.||.|| ..|..||..||:||||.:||:.:.|||||.||||..|||:|
Mouse  3346 EGFDFGVRQNGERVNHVNLPPWARNDPRLFILIHRQALESDHVSQNICHWIDLVFGYKQKGKASV 3410

  Fly   557 KSKNVC---------LTLVD---QHRNL---------SQRGIVQLFASAHPPR 588
            ::.||.         ::.|:   |.|.|         :.|   |||.:||..|
Mouse  3411 QAINVFHPATYFGMDVSAVEDPVQRRALETMIKTYGQTPR---QLFHTAHASR 3460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdr81NP_609535.1 Beach 345..588 CDD:100117 84/300 (28%)
WD40 <1644..1877 CDD:225201
WD40 1651..1876 CDD:295369
WD40 repeat 1662..1705 CDD:293791
WD40 repeat 1710..1744 CDD:293791
WD40 repeat 1752..1788 CDD:293791
WD40 repeat 1799..1836 CDD:293791
LystXP_006516624.1 PH_BEACH 3058..3153 CDD:373333
Beach 3170..3460 CDD:214982 84/300 (28%)
WD40 3515..3816 CDD:392136
WD40 repeat 3607..3652 CDD:293791
WD40 repeat 3657..3693 CDD:293791
WD40 repeat 3700..3733 CDD:293791
WD40 repeat 3743..3784 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1786
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101142at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.