DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdr81 and LYST

DIOPT Version :9

Sequence 1:NP_609535.1 Gene:Wdr81 / 34616 FlyBaseID:FBgn0032395 Length:1953 Species:Drosophila melanogaster
Sequence 2:XP_011542333.1 Gene:LYST / 1130 HGNCID:1968 Length:3855 Species:Homo sapiens


Alignment Length:265 Identity:78/265 - (29%)
Similarity:118/265 - (44%) Gaps:51/265 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 NLREY------TEMWCNGQLSNFDYLTILNNACGRSLTNAAYHHIMPWV-TDFSGRGGG-----A 392
            ||.||      |.:|..||::||:|||.||...|||..:...:.:.|:: .|:......     .
Human  3175 NLLEYGNITALTNLWYTGQITNFEYLTHLNKHAGRSFNDLMQYPVFPFILADYVSETLDLNDLLI 3239

  Fly   393 WRDLTKS---KYRLNKGDVHLDLMYAHASQH---GSADGSYQAIGDQAP-----HHVSDFLSEIT 446
            :|:|:|.   :|: .|.|.::| .|.:..:.   |:.:      .|..|     |:.|.:.:..|
Human  3240 YRNLSKPIAVQYK-EKEDRYVD-TYKYLEEEYRKGARE------DDPMPPVQPYHYGSHYSNSGT 3296

  Fly   447 YFVYMARRTP--QSILCAHVRPIWVPAEYPVSIQ---RLQEWTP----DECIPEFYSDPMIF--- 499
            ...::.|..|  :..|....:...:|.....|..   ||..:..    .|.||||:..|...   
Human  3297 VLHFLVRMPPFTKMFLAYQDQSFDIPDRTFHSTNTTWRLSSFESMTDVKELIPEFFYLPEFLVNR 3361

  Fly   500 -------KSIHEDLPDLELPAWA-TCPEDFICKHREALESQYVSERLHHWIDLNFGYKLSGKAAV 556
                   :...|.:..:.||.|| ..|..||..||:||||.|||:.:..||||.||||..|||:|
Human  3362 EGFDFGVRQNGERVNHVNLPPWARNDPRLFILIHRQALESDYVSQNICQWIDLVFGYKQKGKASV 3426

  Fly   557 KSKNV 561
            ::.||
Human  3427 QAINV 3431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdr81NP_609535.1 Beach 345..588 CDD:100117 74/254 (29%)
WD40 <1644..1877 CDD:225201
WD40 1651..1876 CDD:295369
WD40 repeat 1662..1705 CDD:293791
WD40 repeat 1710..1744 CDD:293791
WD40 repeat 1752..1788 CDD:293791
WD40 repeat 1799..1836 CDD:293791
LYSTXP_011542333.1 PH_BEACH 3066..3171 CDD:275391
Beach 3186..3476 CDD:214982 74/254 (29%)
WD40 <3530..3837 CDD:225201
WD40 repeat 3582..3619 CDD:293791
WD40 3583..3832 CDD:295369
WD40 repeat 3623..3668 CDD:293791
WD40 repeat 3673..3709 CDD:293791
WD40 repeat 3716..3749 CDD:293791
WD40 repeat 3759..3800 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1786
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101142at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.