DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh5 and Opn1mw

DIOPT Version :9

Sequence 1:NP_001285859.1 Gene:Rh5 / 34615 FlyBaseID:FBgn0014019 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_446000.1 Gene:Opn1mw / 89810 RGDID:620978 Length:359 Species:Rattus norvegicus


Alignment Length:359 Identity:88/359 - (24%)
Similarity:167/359 - (46%) Gaps:64/359 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RGFREAPIYYHAGFYIA------FIVLMLSSIFGNGLVIWIFSTSKSLRTPSNLLILNLAIFDL- 99
            ||..|.|.|:.|..::.      .|:::::|:|.||||:......|.||.|.|.:::|||:.|| 
  Rat    32 RGPFEGPNYHIAPRWVYHLTSTWMILVVIASVFTNGLVLAATMRFKKLRHPLNWILVNLAVADLA 96

  Fly   100 --FMCTNMPHYLINATVGYIVGGDLGCDIYALNG------GISGMGASITNAFIAFDRYKTISNP 156
              .:.:.:.  ::|...||.|   ||..:..:.|      ||:|:.:.   |.|:::|:..:..|
  Rat    97 ETIIASTIS--VVNQIYGYFV---LGHPLCVIEGYIVSLCGITGLWSL---AIISWERWLVVCKP 153

  Fly   157 -----IDGRLSYGQIVLLILFTWLWATPFSVLPLFQIWGRYQPEGFLTTCSFDYLTNTDEN--RL 214
                 .|.:|:    .:.|:|:|:||..::..|:|. |.||.|.|..|:|..|..:.|...  :.
  Rat   154 FGNVRFDAKLA----TVGIVFSWVWAAVWTAPPIFG-WSRYWPYGLKTSCGPDVFSGTSYPGVQS 213

  Fly   215 FVRTIFVWSYVIPMTMILVSYYKLFTHVRVHEKMLAEQAKKMNVKSLSANANADNMSVELRIAKA 279
            ::..:.|...:.|:::|::.|.:::..:|.    :|:|.|:          :......|..:.:.
  Rat   214 YMMVLMVTCCIFPLSIIVLCYLQVWLAIRA----VAKQQKE----------SESTQKAEKEVTRM 264

  Fly   280 ALIIYMLFILAWTPYSVVALIGCFGEQQ---LITPFVSMLPCLACKSVSCLDPWVYATSHPKYR- 340
            .:::...:.|.|.||:..|   ||....   ...|.|:.||....||.:..:|.:|...:.::| 
  Rat   265 VVVMVFAYCLCWGPYTFFA---CFATAHPGYAFHPLVASLPSYFAKSATIYNPIIYVFMNRQFRN 326

  Fly   341 --LELERRLPWLGIREKHATSGTSGGQESVASVS 372
              |:|      .|.:...::..:|..:..|:|||
  Rat   327 CILQL------FGKKVDDSSELSSTSKTEVSSVS 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh5NP_001285859.1 7tm_4 60..>236 CDD:304433 52/191 (27%)
7tm_1 69..332 CDD:278431 69/281 (25%)
Opn1mwNP_446000.1 Required for 11-cis-retinal regeneration. /evidence=ECO:0000250|UniProtKB:P04001 12..38 3/5 (60%)
7tm_1 66..317 CDD:278431 69/280 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.