DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh5 and OR12D3

DIOPT Version :9

Sequence 1:NP_001285859.1 Gene:Rh5 / 34615 FlyBaseID:FBgn0014019 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_112221.1 Gene:OR12D3 / 81797 HGNCID:13963 Length:316 Species:Homo sapiens


Alignment Length:127 Identity:31/127 - (24%)
Similarity:54/127 - (42%) Gaps:1/127 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 FYIAFIVLMLSSIFGNGLVIWIFSTSKSLRTPSNLLILNLAIFDL-FMCTNMPHYLINATVGYIV 118
            |:..|:::.|.::.|||.::.:......|.:|....:.||:..|: :....:|..|:|.......
Human    25 FFGIFLIIYLINLIGNGSILVMVVLEPQLHSPMYFFLGNLSCLDISYSSVTLPKLLVNLVCSRRA 89

  Fly   119 GGDLGCDIYALNGGISGMGASITNAFIAFDRYKTISNPIDGRLSYGQIVLLILFTWLWATPF 180
            ...|||..........|...:|..|.:||||:..|.||:...:.....|.::|....|...|
Human    90 ISFLGCITQLHFFHFLGSTEAILLAIMAFDRFVAICNPLRYTVIMNPQVCILLAAAAWLISF 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh5NP_001285859.1 7tm_4 60..>236 CDD:304433 29/122 (24%)
7tm_1 69..332 CDD:278431 28/113 (25%)
OR12D3NP_112221.1 7tmA_OR12D-like 23..293 CDD:320581 31/127 (24%)
TM helix 1 24..50 CDD:320581 6/24 (25%)
TM helix 2 57..83 CDD:320581 5/25 (20%)
TM helix 3 95..125 CDD:320581 8/29 (28%)
TM helix 4 138..159 CDD:320581 4/14 (29%)
TM helix 5 193..223 CDD:320581
TM helix 6 231..261 CDD:320581
TM helix 7 268..293 CDD:320581
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7519
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.