DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh5 and opn6a

DIOPT Version :9

Sequence 1:NP_001285859.1 Gene:Rh5 / 34615 FlyBaseID:FBgn0014019 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001073125.1 Gene:opn6a / 780836 ZFINID:ZDB-GENE-061201-30 Length:419 Species:Danio rerio


Alignment Length:330 Identity:75/330 - (22%)
Similarity:147/330 - (44%) Gaps:32/330 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 MVHAHWRG------FREAPIYYHAGFYIAFIVLMLS--SIFGNGLVIWIFSTSKSLRTPSNLLIL 92
            :|:..||.      .|:.|:.......|...:|:|.  |.|||.:||::....:|...|::.|.|
Zfish     9 VVNIPWRNNNFSLMSRDPPLSDQGETIIGVYLLILGWLSWFGNSIVIFVLFRQRSTLQPTDYLTL 73

  Fly    93 NLAIFDLFMCT------NMPHYLINATVGYIVGGDLGCDIYALNGGISGMGASITNAFIAFDRYK 151
            |||:.|..:..      .:..:.|....|||:.....|.:......:.|:.:..|...|:..|:.
Zfish    74 NLAVSDASISVFGYSRGILEIFNIFKDSGYIISSVWTCQVDGFFTLVFGLSSINTLTVISITRFI 138

  Fly   152 TISNPIDGR-LSYGQIVLLILFTWLWATPFSVLPLFQIWGRYQPEGFLTTCSFDYL--TNTDENR 213
            ...:|.... ::...:.:.::|.|:.|..:|..|:.. ||.|...|: .||..|::  ..:..::
Zfish   139 KGCHPHKAHCITNSTVAVCVVFIWIGAFFWSAAPVLG-WGSYTDRGY-GTCEIDWVKANYSTIHK 201

  Fly   214 LFVRTIFVWSYVIPMTMILVSYYKLFTHVRVHEKMLAEQAKKMNVKSLSANANADNMSVELRIAK 278
            .::.:||::.:::|:.::|..|..:...|           |:.|..:...:.:.....:|..:..
Zfish   202 SYIISIFIFCFLVPVLLMLFCYISIINTV-----------KRGNAMNADGDLSDRQRKIERDVTI 255

  Fly   279 AALIIYMLFILAWTPYSVVALIGCFGEQQLITPFVSMLPCLACKSVSCLDPWVYATSHPKYRLEL 343
            .:::|...|||||:||:||::...:|..  :....|:...|..||.|..:|.:|.....|:|.::
Zfish   256 VSIVICTAFILAWSPYAVVSMWSAWGFH--VPNLTSIFTRLFAKSASFYNPLIYFGLSSKFRKDV 318

  Fly   344 ERRLP 348
            ...||
Zfish   319 SVLLP 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh5NP_001285859.1 7tm_4 60..>236 CDD:304433 42/186 (23%)
7tm_1 69..332 CDD:278431 60/271 (22%)
opn6aNP_001073125.1 7tm_1 50..307 CDD:278431 60/271 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.