DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh5 and OPN1MW2

DIOPT Version :9

Sequence 1:NP_001285859.1 Gene:Rh5 / 34615 FlyBaseID:FBgn0014019 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001041646.1 Gene:OPN1MW2 / 728458 HGNCID:26952 Length:364 Species:Homo sapiens


Alignment Length:361 Identity:90/361 - (24%)
Similarity:165/361 - (45%) Gaps:68/361 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RGFREAPIY-------YH-AGFYIAFIVLMLSSIFGNGLVIWIFSTSKSLRTPSNLLILNLAIFD 98
            ||..|.|.|       || ...::.|:|  ::|:|.||||:......|.||.|.|.:::|||:.|
Human    37 RGPFEGPNYHIAPRWVYHLTSVWMIFVV--IASVFTNGLVLAATMKFKKLRHPLNWILVNLAVAD 99

  Fly    99 L---FMCTNMPHYLINATVGYIVGGDLGCDIYALNG------GISGMGASITNAFIAFDRYKTIS 154
            |   .:.:.:.  ::|...||.|   ||..:..|.|      ||:|:.:.   |.|:::|:..:.
Human   100 LAETVIASTIS--VVNQVYGYFV---LGHPMCVLEGYTVSLCGITGLWSL---AIISWERWMVVC 156

  Fly   155 NP-----IDGRLSYGQIVLLILFTWLWATPFSVLPLFQIWGRYQPEGFLTTCSFDYLTNTDEN-- 212
            .|     .|.:|:    ::.|.|:|:||..::..|:|. |.||.|.|..|:|..|..:.:...  
Human   157 KPFGNVRFDAKLA----IVGIAFSWIWAAVWTAPPIFG-WSRYWPHGLKTSCGPDVFSGSSYPGV 216

  Fly   213 RLFVRTIFVWSYVIPMTMILVSYYKLFTHVRVHEKMLAEQAKKMNVKSLSANANADNMSVELRIA 277
            :.::..:.|...:.|:::|::.|.:::..:|.    :|:|.|:          :......|..:.
Human   217 QSYMIVLMVTCCITPLSIIVLCYLQVWLAIRA----VAKQQKE----------SESTQKAEKEVT 267

  Fly   278 KAALIIYMLFILAWTPYSVVALIGCFGEQQLITPF---VSMLPCLACKSVSCLDPWVYATSHPKY 339
            :..:::.:.|...|.||   |...||.......||   ::.||....||.:..:|.:|...:.::
Human   268 RMVVVMVLAFCFCWGPY---AFFACFAAANPGYPFHPLMAALPAFFAKSATIYNPVIYVFMNRQF 329

  Fly   340 R---LELERRLPWLGIREKHATSGTSGGQESVASVS 372
            |   |:|      .|.:....:..:|..:..|:|||
Human   330 RNCILQL------FGKKVDDGSELSSASKTEVSSVS 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh5NP_001285859.1 7tm_4 60..>236 CDD:304433 52/191 (27%)
7tm_1 69..332 CDD:278431 69/281 (25%)
OPN1MW2NP_001041646.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
Required for 11-cis-retinal regeneration. /evidence=ECO:0000269|PubMed:30948514 17..43 3/5 (60%)
7tm_4 61..>178 CDD:304433 37/130 (28%)
7tm_1 71..322 CDD:278431 69/280 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.