DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh5 and opn4a

DIOPT Version :9

Sequence 1:NP_001285859.1 Gene:Rh5 / 34615 FlyBaseID:FBgn0014019 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001122233.1 Gene:opn4a / 571624 ZFINID:ZDB-GENE-070111-2 Length:593 Species:Danio rerio


Alignment Length:346 Identity:113/346 - (32%)
Similarity:193/346 - (55%) Gaps:37/346 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 HAGFYIAFIVLM--LSSIFGNGLVIWIFSTSKSLRTPSNLLILNLAIFDLFMC-TNMPHYLINAT 113
            ||.:.|..::|.  ::.:.||.|||:.||.|::||||:||.|:||||.|..|| |..|.:...:.
Zfish    73 HAHYTIGAVILTVGITGMLGNFLVIYAFSRSRTLRTPANLFIINLAITDFLMCATQAPIFFTTSM 137

  Fly   114 VGYIVGGDLGCDIYALNGGISGMGASITNAFIAFDRYKTISNPID--GRLSYGQIVLLILFTWLW 176
            ....:.|:.||::||..|.:.|:.:.||...||.|||..|:.|:.  |.||..:.:|::|..|::
Zfish   138 HKRWIFGEKGCELYAFCGALFGICSMITLMVIAVDRYFVITRPLASIGVLSQKRALLILLVAWVY 202

  Fly   177 ATPFSVLPLFQIWGRYQPEGFLTTCSFDYLTNTDENRLFVRTIFVWSYVIPMTMILVSYYKLFTH 241
            :..:|:.|.|. |..|.|||.||:|::||:|.|...|.:...:|::.:.||:.:|:..|:.:|..
Zfish   203 SLGWSLPPFFG-WSAYVPEGLLTSCTWDYMTFTPSVRAYTMLLFIFVFFIPLIVIIYCYFFIFRS 266

  Fly   242 VRVHEKMLAEQAKKMNVKSLSANANADN----------MSVELRIAKAALIIYMLFILAWTPYSV 296
            :|...:.:.:             .|.||          :..|.::||.|||:.::::::|:|||.
Zfish   267 IRTTNEAVGK-------------INGDNKRDSMKRFQRLKNEWKMAKIALIVILMYVISWSPYST 318

  Fly   297 VALIGCFGEQQLITPFVSMLPCLACKSVSCLDPWVYATSHPKYRLELERRLPWLGI------REK 355
            |||....|....:||:::.:|.:..|:.:..:|.:||.:||||||.:.:.:|.|.:      |:.
Zfish   319 VALTAFAGYSDFLTPYMNSVPAVIAKASAIHNPIIYAITHPKYRLAIAKYIPCLRLLLCIPKRDL 383

  Fly   356 HA--TSGTSGGQESVASVSGD 374
            |:  :|..|..:.:|.|.|.|
Zfish   384 HSFHSSLMSTRRSTVTSQSSD 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh5NP_001285859.1 7tm_4 60..>236 CDD:304433 67/180 (37%)
7tm_1 69..332 CDD:278431 91/275 (33%)
opn4aNP_001122233.1 7tm_4 83..>257 CDD:304433 66/174 (38%)
7tm_1 92..354 CDD:278431 91/275 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 397..449 4/8 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 547..593
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590454
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24240
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.