DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh5 and opn7a

DIOPT Version :9

Sequence 1:NP_001285859.1 Gene:Rh5 / 34615 FlyBaseID:FBgn0014019 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001303877.1 Gene:opn7a / 570397 ZFINID:ZDB-GENE-140106-15 Length:455 Species:Danio rerio


Alignment Length:288 Identity:73/288 - (25%)
Similarity:142/288 - (49%) Gaps:15/288 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 IAFIVLMLSSIFGNGLVIWIFSTSKSLRTPSNLLILNLAIFDLFMCTNMPHYLINATVGY-IVGG 120
            |.:.:..:.|:.||.:::::....|.|..|:...|:||||.||.|..::....:.:::.: .:.|
Zfish    23 IVYSLFGVCSLCGNSMLLYVSYKKKHLLKPAEFFIVNLAISDLGMTLSLYPLAVTSSIAHRWLYG 87

  Fly   121 DLGCDIYALNGGISGMGASITNAFIAFDRYKTISNPIDG-RLSYGQIVLLILFTWLWATPFSVLP 184
            ...|.|||..|.:.|:.:..|...::......:..|:.| |.||....:||:..|.::..|:..|
Zfish    88 RTVCVIYAFCGVLFGICSLTTLTILSTVCCLKVCYPLHGNRFSYEHGRMLIVCAWAYSLVFACSP 152

  Fly   185 LFQIWGRYQPEGFLTTCSFDYLTNTDEN--RLFVRTIFVWSYVIPMTMILVSYYKLFTHVRVHEK 247
            |.. ||:|.||.:.|.|..|:..:...:  |.:...:|:..|::|..:|::||.::...||    
Zfish   153 LAH-WGQYGPEPYGTACCIDWAWSNQNSVARSYTTVLFIACYLVPCVIIIISYTRILITVR---- 212

  Fly   248 MLAEQAKKMNVKSLSANANADNMSVELRIAKAALIIYMLFILAWTPYSVVALIGCFGEQQLITPF 312
                ::::...:.:||.....|  ::..|.|.::.:.:.|..||:||::|::...||....|.|.
Zfish   213 ----ESRRAVEQHVSAQTRMGN--IQTIIVKLSVAVCIGFFTAWSPYALVSMWAAFGHFDDIPPM 271

  Fly   313 VSMLPCLACKSVSCLDPWVYATSHPKYR 340
            ...:|.:..||.:..:|.:|....|.:|
Zfish   272 AFAVPAMFAKSSTLYNPLIYLLLKPNFR 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh5NP_001285859.1 7tm_4 60..>236 CDD:304433 47/179 (26%)
7tm_1 69..332 CDD:278431 68/266 (26%)
opn7aNP_001303877.1 7TM_GPCR_Srd 23..235 CDD:304638 54/222 (24%)
7tm_1 35..291 CDD:278431 68/266 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.