DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh5 and opn5

DIOPT Version :9

Sequence 1:NP_001285859.1 Gene:Rh5 / 34615 FlyBaseID:FBgn0014019 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001186975.1 Gene:opn5 / 564181 ZFINID:ZDB-GENE-041001-179 Length:352 Species:Danio rerio


Alignment Length:297 Identity:90/297 - (30%)
Similarity:151/297 - (50%) Gaps:29/297 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 REAPIYYHAGFYIAFIVLMLSSIFGNGLVIWIFSTSKSLRTPSNLLILNLAIFDL-FMCTNMPHY 108
            :||.|.  |.|||  :|:.:.|..|||.|:::....|:...|..::.|||||||. ...:..|.:
Zfish    28 KEADIV--AAFYI--LVIGILSATGNGYVMYMTFKRKTKLKPPEIMTLNLAIFDFGISVSGKPFF 88

  Fly   109 LINATVGYIVGGDLGCDIYALNGGISGMGASITNAFIAFDRYKTISNPIDGRLSYG------QIV 167
            ::::.....:.|..||..|...|...|.|:.||...::||||..|.:     |.||      ...
Zfish    89 IVSSFSHRWLFGWQGCRYYGWAGFFFGCGSLITMTVVSFDRYLKICH-----LRYGTWLKRHHAF 148

  Fly   168 LLILFTWLWATPFSVLPLFQIWGRYQPEGFLTTCSFD-YLTNTD-ENRLFVRTIFVWSYVIPMTM 230
            |.::|.|.:|..::.:|:.. ||.|.||.|.|:|:.| :||... ..:.||..:..:..:.|..:
Zfish   149 LSVVFIWAYAAFWATMPVVG-WGNYAPEPFGTSCTLDWWLTQASVSGQSFVMCMLFFCLIFPTVI 212

  Fly   231 ILVSYYKLFTHVRVHEKMLAEQAKKMNVKSLSANANADNMSVELRIAKAALIIYMLFILAWTPYS 295
            |:.||..:...|    |..|::....:.:      |.:|.|:|:::.|.|::|...|::||.||:
Zfish   213 IVFSYVMIIFKV----KSSAKEVSHFDTR------NKNNHSLEMKLTKVAMLICAGFLIAWIPYA 267

  Fly   296 VVALIGCFGEQQLITPFVSMLPCLACKSVSCLDPWVY 332
            ||:::..|||...:...||::|.|..||.:..:|.:|
Zfish   268 VVSVMSAFGEPDSVPIPVSVVPTLLAKSSAMYNPIIY 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh5NP_001285859.1 7tm_4 60..>236 CDD:304433 54/184 (29%)
7tm_1 69..332 CDD:278431 80/271 (30%)
opn5NP_001186975.1 7tm_1 48..304 CDD:278431 80/271 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.