DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh5 and opn4xb

DIOPT Version :9

Sequence 1:NP_001285859.1 Gene:Rh5 / 34615 FlyBaseID:FBgn0014019 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001245152.1 Gene:opn4xb / 563080 ZFINID:ZDB-GENE-070705-526 Length:460 Species:Danio rerio


Alignment Length:337 Identity:109/337 - (32%)
Similarity:180/337 - (53%) Gaps:23/337 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 HAGFYIAFIVLMLSS--IFGNGLVIWIFSTSKSLRTPSNLLILNLAIFDLFMC-TNMPHYLINAT 113
            |..:.|||::|::.:  :.||.||::.|.::|.||:..|..|:|||:.|..|. |..|.:.||..
Zfish    16 HVHYIIAFLILIIGTLGVSGNALVMFAFYSNKKLRSLPNYFIMNLAVSDFLMAITQSPIFFINCL 80

  Fly   114 VGYIVGGDLGCDIYALNGGISGMGASITNAFIAFDRYKTISNPI-----DGRLSYGQIVLLILFT 173
            ....:.|:|||.|||..|.:.|:.:.|....|:.|||..|:.|:     :.:...|   |.||..
Zfish    81 YKEWMFGELGCKIYAFCGALFGITSMINLLAISIDRYLVITKPLQTIQWNSKRRTG---LAILCI 142

  Fly   174 WLWATPFSVLPLFQIWGRYQPEGFLTTCSFDYLTNTDENRLFVRTIFVWSYVIPMTMILVSYYKL 238
            ||::..:|:.||.. |..|.|||.:|:|::||::.:..|:.:...:..:.:.||:::||..|..:
Zfish   143 WLYSLAWSLAPLIG-WSSYIPEGLMTSCTWDYVSPSPANKSYTMMLCCFVFFIPLSIILYCYLFM 206

  Fly   239 FTHVRVHEK---MLAEQAKKMNVKSLSANANADNMSVELRIAKAALIIYMLFILAWTPYSVVALI 300
            |..||...:   ||:.| |...||..|       |..|.::||.|.::.::::|:|.||:.|.|:
Zfish   207 FLSVRQASRDLEMLSSQ-KSSFVKQQS-------MRSEWKLAKIAAVVIVVYVLSWAPYACVTLV 263

  Fly   301 GCFGEQQLITPFVSMLPCLACKSVSCLDPWVYATSHPKYRLELERRLPWLGIREKHATSGTSGGQ 365
            ...|.|.::||:...||.:..||.:..:|::||..|.|||..|..|:|.|....:....|.|...
Zfish   264 AWAGHQDVLTPYSKTLPAVLAKSSAIYNPFIYAIIHNKYRATLAERVPGLSCLSRSQKDGLSSST 328

  Fly   366 ESVASVSGDTLA 377
            .|.||....:::
Zfish   329 NSDASAQDSSVS 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh5NP_001285859.1 7tm_4 60..>236 CDD:304433 59/183 (32%)
7tm_1 69..332 CDD:278431 89/271 (33%)
opn4xbNP_001245152.1 7tm_4 26..>229 CDD:304433 67/207 (32%)
7tm_1 35..295 CDD:278431 89/271 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590453
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48050
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24240
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.