DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh5 and opn7c

DIOPT Version :9

Sequence 1:NP_001285859.1 Gene:Rh5 / 34615 FlyBaseID:FBgn0014019 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001038457.1 Gene:opn7c / 562695 ZFINID:ZDB-GENE-060526-333 Length:404 Species:Danio rerio


Alignment Length:302 Identity:78/302 - (25%)
Similarity:149/302 - (49%) Gaps:34/302 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 YIAFIVLMLSSIFGNGLVIWIFSTSKSLRTPSNLLILNLAIFDLFMCTNM-PHYLINATVGYIVG 119
            |..|.||   |:.|||:::::....:|...|:...::||::.||.|..:: |..:.:|.....:.
Zfish    26 YSVFFVL---SLLGNGMLLFVAYRKRSSLKPAEFFVVNLSVSDLGMTLSLFPLAIPSALAHRWLF 87

  Fly   120 GDLGCDIYALNGGISGMGASITNAF---------IAFDRYKTISNPIDGRLSYGQIVLLILFTWL 175
            |::.|..||:.|.:.|: .|:||..         :.|..|       ..:.|.....::::..|.
Zfish    88 GEITCLCYAVCGVLFGL-CSLTNLTALSSVCCLKVCFPNY-------GNKFSSSHACVMVIGVWC 144

  Fly   176 WATPFSVLPLFQIWGRYQPEGFLTTCSFDYLTNTDE--NRLFVRTIFVWSYVIPMTMILVSYYKL 238
            :|:.|:|.||.. ||.:.||.:.|.|..::.|.:.:  ...::.::|::.||:|.|:|::||..:
Zfish   145 YASVFAVGPLVH-WGSFGPEPYGTACCINWYTPSHDALAMSYIISLFIFCYVVPCTIIILSYTFI 208

  Fly   239 FTHVRVHEKMLAEQAKKMNVKSLSANANADNMSVELRIAKAALIIYMLFILAWTPYSVVALIGCF 303
            ...||.     ::||.:.:|...:...||..:.|:|.:|     :.:.|:.||:||::||:...|
Zfish   209 LVTVRG-----SQQAVQQHVSPQTKVTNAHALIVKLSVA-----VCIGFLTAWSPYAIVAMWAAF 263

  Fly   304 GEQQLITPFVSMLPCLACKSVSCLDPWVYATSHPKYRLELER 345
            ...:.:.|....|..:..||.:..:|.||....|.:|..|.:
Zfish   264 SANEQVPPTAFALAAIMAKSSTIYNPMVYLLFKPNFRKSLSQ 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh5NP_001285859.1 7tm_4 60..>236 CDD:304433 47/187 (25%)
7tm_1 69..332 CDD:278431 68/274 (25%)
opn7cNP_001038457.1 7tm_4 26..>214 CDD:304433 51/199 (26%)
7tm_1 36..292 CDD:278431 68/274 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D318027at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.