DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh5 and valopb

DIOPT Version :9

Sequence 1:NP_001285859.1 Gene:Rh5 / 34615 FlyBaseID:FBgn0014019 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001103750.1 Gene:valopb / 560921 ZFINID:ZDB-GENE-040724-41 Length:392 Species:Danio rerio


Alignment Length:297 Identity:73/297 - (24%)
Similarity:132/297 - (44%) Gaps:20/297 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 APIYYHAGFYIAFIVLMLSSIFGNGLVIWIFSTSKSLRTPSNLLILNLAIFDLF--MCTNMPHYL 109
            ||..|.....:.|||..| ||..|..|:.:....|.||.|.|.:|:||::.|..  |......:|
Zfish    29 APWNYTFLACLMFIVTSL-SITENFTVMLVTYRFKQLRKPLNYIIVNLSVADFLVSMTGGTISFL 92

  Fly   110 INATVGYIVGGDLGCDIYALNGGISGMGASITNAFIAFDRYKTISNPIDG-RLSYGQIVLLILFT 173
            .||. |:...|...|.:........|:.|..:.|.:||:|:..|..|:.. ||......:.::|.
Zfish    93 TNAR-GFFFLGVWACVLEGFAVTFFGIVALWSLAILAFERFFVICRPLKNVRLGGKHAAMGLIFV 156

  Fly   174 WLWATPFSVLPLFQIWGRYQPEGFLTTCSFDYLTNTDENRLFVRTIFVWSYVIPMTMILVSYYKL 238
            |.::..:::.|:.. |..|......|||..::.:....:..::.|.||..:::|:.:|::||.||
Zfish   157 WTFSFIWTIPPVLG-WNSYTVSKIGTTCEPNWYSTNYYDHTYIITFFVTCFILPLGVIIISYGKL 220

  Fly   239 FTHVRVHEKMLAEQAKKMNVKSLSANANADNMSVELRIAKAALIIYMLFILAWTPYSVVALIGCF 303
            ...:|          |..|......||...:..|    |:..:::.:.|::.||||:..::....
Zfish   221 MQKLR----------KVSNTHGRLGNARKPDREV----ARMVVVMIVAFMVGWTPYAAFSITVTA 271

  Fly   304 GEQQLITPFVSMLPCLACKSVSCLDPWVYATSHPKYR 340
            .....|.|.:..:|....|:.:..:|.:|...:.::|
Zfish   272 CPTIYIDPRLGSIPAFFSKTAAVYNPIIYVFMNKQFR 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh5NP_001285859.1 7tm_4 60..>236 CDD:304433 47/178 (26%)
7tm_1 69..332 CDD:278431 62/265 (23%)
valopbNP_001103750.1 7tm_4 38..315 CDD:304433 70/288 (24%)
7tm_1 50..300 CDD:278431 62/265 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.