DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh5 and opn6b

DIOPT Version :9

Sequence 1:NP_001285859.1 Gene:Rh5 / 34615 FlyBaseID:FBgn0014019 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001303879.1 Gene:opn6b / 557053 ZFINID:ZDB-GENE-030616-402 Length:391 Species:Danio rerio


Alignment Length:316 Identity:78/316 - (24%)
Similarity:135/316 - (42%) Gaps:58/316 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 GFYIAFIVLMLSSIFGNGLVIWIFSTSKSLRTPSNLLILNLAI-----------------FDLFM 101
            |.|:  ::|...|..|||.||.:.:..:....|.:.|.|||||                 ||:| 
Zfish    25 GVYL--VILGWLSWIGNGTVILLLTKQRKALEPQDFLTLNLAISDASISIFGYSRGILEVFDVF- 86

  Fly   102 CTNMPHYLINATVGYIVGGDLGCDIYALNGGISGMGASITNAFIAFDRYKTISNPIDG-RLSYGQ 165
                      ...||::.....|.:......:.|:.:..|...|:..||....:|... .::...
Zfish    87 ----------RDEGYLIKTFWTCKVDGFLILLFGLISINTLTAISVIRYIKGCHPHHAHHINKRN 141

  Fly   166 IVLLILFTWLWATPFSVLPLFQIWGRYQPEGFLTTCSFDY--LTNTDENRLFVRTIFVWSYVIPM 228
            |.|:|...||:...::..||.. ||.|:..|: .||..|:  ...:...:|:|..||.:::.:|:
Zfish   142 ICLVITAVWLFCLFWAGAPLLG-WGSYRARGY-GTCEIDWTRALYSIPFKLYVIGIFFFNFFVPL 204

  Fly   229 TMILVSYYKLFTHVRVHEKM-----LAEQAKKMNVKSLSANANADNMSVELRIAKAALIIYMLFI 288
            .:|:.:|..:...|....|.     ::|:.||                :|..|.:.:||:...|:
Zfish   205 FIIVFAYVSIIRTVNSSHKSSQGGDVSERQKK----------------IERSITRVSLILCAAFL 253

  Fly   289 LAWTPYSVVALIGCFGEQQLITPFVSMLPCLACKSVSCLDPWVYATSHPKYRLELE 344
            |||:||:|:::....|.|  |.....:|..|..||.|..:|::|.....|:|.:|:
Zfish   254 LAWSPYAVISMWSALGYQ--IPTLNGILASLFAKSASFYNPFIYIGMSSKFRKDLQ 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh5NP_001285859.1 7tm_4 60..>236 CDD:304433 46/195 (24%)
7tm_1 69..332 CDD:278431 70/287 (24%)
opn6bNP_001303879.1 7tm_1 38..295 CDD:278431 70/287 (24%)
7tm_4 <204..306 CDD:304433 30/119 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.