DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh5 and rgra

DIOPT Version :9

Sequence 1:NP_001285859.1 Gene:Rh5 / 34615 FlyBaseID:FBgn0014019 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001017877.1 Gene:rgra / 550575 ZFINID:ZDB-GENE-040924-6 Length:295 Species:Danio rerio


Alignment Length:309 Identity:81/309 - (26%)
Similarity:131/309 - (42%) Gaps:56/309 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GFREAPIYYHAGFYIAFIVLMLSSIFGNGLVIWIFSTSKSLRTPSNLLILNLAIFDLFMCTNMPH 107
            ||.|..::   ......:|..|...|.|.:.:..|...:.||||||.|:.:||:.|:.:.||...
Zfish    10 GFSEFDVF---SLGSCLLVEGLLGFFLNAVTVIAFLKIRELRTPSNFLVFSLAMADMGISTNATV 71

  Fly   108 YLINATVGYIVGGDLGCDIYALNGGISGMGASITNAFIAFDRYKTISNPIDGRLSYGQIVLLILF 172
            ...::.:.|...|..||..:...|.::.:.:....|.||:|||.......  :|.:...:.|:||
Zfish    72 AAFSSFLRYWPYGSDGCQTHGFQGFMTALASIHFIAAIAWDRYHQYCTRT--KLQWSSAITLVLF 134

  Fly   173 TWLWATPFSVLPLFQIWGRYQPEGFLTTCSFDYLTNTDENRLFVRTIFVWSYVIPMT-------- 229
            |||:...::.:|||. ||.|..|...|.|:.|| :..|.|.:        ||:|||:        
Zfish   135 TWLFTAFWAAMPLFG-WGEYDYEPLRTCCTLDY-SKGDRNYV--------SYLIPMSIFNMGIQV 189

  Fly   230 -MILVSYYKLFTHVRVHEKMLAE--QAKKMNVKSLSANANADNMSVELRIAKAALIIYMLFILAW 291
             ::|.||..:       :|...:  |||             .|....|:.        |||  .|
Zfish   190 FVVLSSYQSI-------DKKFKKTGQAK-------------FNCGTPLKT--------MLF--CW 224

  Fly   292 TPYSVVALIGCFGEQQLITPFVSMLPCLACKSVSCLDPWVYATSHPKYR 340
            .||.::|.........|::|.:.|:..:..|:....:.:|||..:..||
Zfish   225 GPYGILAFYAAVENATLVSPKLRMIAPILAKTSPTFNVFVYALGNENYR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh5NP_001285859.1 7tm_4 60..>236 CDD:304433 55/184 (30%)
7tm_1 69..332 CDD:278431 70/273 (26%)
rgraNP_001017877.1 7tm_1 34..265 CDD:278431 70/272 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.