DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh5 and rrh

DIOPT Version :9

Sequence 1:NP_001285859.1 Gene:Rh5 / 34615 FlyBaseID:FBgn0014019 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001004654.1 Gene:rrh / 447916 ZFINID:ZDB-GENE-040912-94 Length:334 Species:Danio rerio


Alignment Length:301 Identity:86/301 - (28%)
Similarity:144/301 - (47%) Gaps:40/301 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 AGFYIAFIVLMLSSIFGNGLVIWIFSTSKSLRTPSNLLILNLAIFDLFMCTNMPHYLINATVGYI 117
            |.:.|...|:.|||   |.:|:.:|...:.|||.:|.:|:|||..|:.:          |.:||.
Zfish    29 AAYLITAGVISLSS---NIVVLLMFVKFRELRTATNAIIINLAFTDIGV----------AGIGYP 80

  Fly   118 VG-----------GDLGCDIYALNGGISGMGASITNAFIAFDRYKTISNP-IDGRLSYGQIVLLI 170
            :.           |.:||.|||......||.:......:|.|||.||..| |..:|:.....|||
Zfish    81 MSAASDLHGSWKFGYMGCQIYAALNIFFGMASIGLLTVVAIDRYLTICRPDIGQKLTTRSYTLLI 145

  Fly   171 LFTWLWATPFSVLPLFQIWGRYQPEGFLTTCSFDYLTNTDENRLFVRTIFVWSYVIPMTMILVSY 235
            :..||.|..:|.:|:.. |..|.|:....||:.::..|......:..|:...:::||::::...|
Zfish   146 VAAWLNAVFWSSMPIVG-WAGYAPDPTGATCTINWRNNDTSFVSYTMTVITVNFIIPLSVMFYCY 209

  Fly   236 YKLFTHVRVHEKMLAEQAKKMNVKSLSANANADNMSVELRIAKAALIIYMLFILAWTPYSVVALI 300
            |.:...|           |:....:...:.|.| .|.::.:.|.::|:.::|:.||:|||:|.|.
Zfish   210 YNVSATV-----------KRFKASNCLDSINMD-WSDQMDVTKMSVIMIVMFLAAWSPYSIVCLW 262

  Fly   301 GCFGEQQLI-TPFVSMLPCLACKSVSCLDPWVYATSHPKYR 340
            ..||:.|.| .|...:.|.|| ||.:..:|.:|..::.|:|
Zfish   263 ASFGDPQKIPAPMAIIAPLLA-KSSTFYNPCIYVIANKKFR 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh5NP_001285859.1 7tm_4 60..>236 CDD:304433 53/187 (28%)
7tm_1 69..332 CDD:278431 77/275 (28%)
rrhNP_001004654.1 7tm_1 43..294 CDD:278431 77/274 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48050
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.