DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh5 and Rh3

DIOPT Version :9

Sequence 1:NP_001285859.1 Gene:Rh5 / 34615 FlyBaseID:FBgn0014019 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_524411.1 Gene:Rh3 / 42398 FlyBaseID:FBgn0003249 Length:383 Species:Drosophila melanogaster


Alignment Length:349 Identity:162/349 - (46%)
Similarity:233/349 - (66%) Gaps:10/349 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 MGHGYPAEYQHMVHAHWRGFREAP--IYYHAGFYIAFIVLMLSSIFGNGLVIWIFSTSKSLRTPS 87
            :|...|.|....:..||..:.|.|  :.|..|....|..||  |:.|||||||:||.:|||||||
  Fly    31 LGWNVPPEELRHIPEHWLTYPEPPESMNYLLGTLYIFFTLM--SMLGNGLVIWVFSAAKSLRTPS 93

  Fly    88 NLLILNLAIFDLFMCTNMPHYLINA-TVGYIVGGDLGCDIYALNGGISGMGASITNAFIAFDRYK 151
            |:|::|||..|..|....|.::.|: ..||.: |.|||.|:.:.|..:|:.|..||||||:||:.
  Fly    94 NILVINLAFCDFMMMVKTPIFIYNSFHQGYAL-GHLGCQIFGIIGSYTGIAAGATNAFIAYDRFN 157

  Fly   152 TISNPIDGRLSYGQIVLLILFTWLWATPFSVLPLFQIWGRYQPEGFLTTCSFDYLTNTDENRLFV 216
            .|:.|::|::::|:.:.:|:|.:::|||:.|....:.|||:.|||:||:|:|||||:..:.||||
  Fly   158 VITRPMEGKMTHGKAIAMIIFIYMYATPWVVACYTETWGRFVPEGYLTSCTFDYLTDNFDTRLFV 222

  Fly   217 RTIFVWSYVIPMTMILVSYYKLFTHVRVHEKMLAEQAKKMNVKSLSANANADNMSVELRIAKAAL 281
            ..||.:|:|.|.|||...|.::..||..|||.|.:|||||||:||.:|.:.:..:.|:||||||:
  Fly   223 ACIFFFSFVCPTTMITYYYSQIVGHVFSHEKALRDQAKKMNVESLRSNVDKNKETAEIRIAKAAI 287

  Fly   282 IIYMLFILAWTPYSVVALIGCFGEQQLITPFVSMLPCLACKSVSCLDPWVYATSHPKYRLELERR 346
            .|..||..:||||.|::|||.||::.|:||..:|:|..|||.|:|:||:|||.|||:||:||::|
  Fly   288 TICFLFFCSWTPYGVMSLIGAFGDKTLLTPGATMIPACACKMVACIDPFVYAISHPRYRMELQKR 352

  Fly   347 LPWLGIREK----HATSGTSGGQE 366
            .|||.:.||    .|.:.||..||
  Fly   353 CPWLALNEKAPESSAVASTSTTQE 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh5NP_001285859.1 7tm_4 60..>236 CDD:304433 82/176 (47%)
7tm_1 69..332 CDD:278431 128/263 (49%)
Rh3NP_524411.1 7tm_4 66..>191 CDD:304433 57/127 (45%)
7tm_1 75..338 CDD:278431 128/263 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461667
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D32029at7147
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42416
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24240
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.