DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh5 and ninaE

DIOPT Version :9

Sequence 1:NP_001285859.1 Gene:Rh5 / 34615 FlyBaseID:FBgn0014019 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_524407.1 Gene:ninaE / 42367 FlyBaseID:FBgn0002940 Length:373 Species:Drosophila melanogaster


Alignment Length:364 Identity:135/364 - (37%)
Similarity:198/364 - (54%) Gaps:22/364 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LGDGSVFPMGHGYPAEYQHMVHAHWRGFREA-PIYYHAGFYIAFIVLM-LSSIFGNGLVIWIFST 79
            |.:|||...   ...:..|::..:|..|... ||:  |....|::::: :.|..|||:||:||:|
  Fly    18 LSNGSVVDK---VTPDMAHLISPYWNQFPAMDPIW--AKILTAYMIMIGMISWCGNGVVIYIFAT 77

  Fly    80 SKSLRTPSNLLILNLAIFDL-FMCTNMPHYLINATVGYIVGGDLGCDIYALNGGISGMGASITNA 143
            :||||||:|||::||||.|. .|.||.|...||......|.|.:.|||||..|...|..:..:..
  Fly    78 TKSLRTPANLLVINLAISDFGIMITNTPMMGINLYFETWVLGPMMCDIYAGLGSAFGCSSIWSMC 142

  Fly   144 FIAFDRYKTISNPIDGR-----LSYGQIVLLILFTWLWATPFSVLPLFQIWGRYQPEGFLTTCSF 203
            .|:.|||:.|...:.||     |:.|:|.    :.|..::.:.:.|.|. |.||.|||.||:|..
  Fly   143 MISLDRYQVIVKGMAGRPMTIPLALGKIA----YIWFMSSIWCLAPAFG-WSRYVPEGNLTSCGI 202

  Fly   204 DYLTNTDENRLFVRTIFVWSYVIPMTMILVSYYKLFTHVRVHEKMLAEQAKKMNVKSLSANANAD 268
            |||......|.::....::.|.||:.:|..||:.:...|..|||.:.|||||||||||.::.:|:
  Fly   203 DYLERDWNPRSYLIFYSIFVYYIPLFLICYSYWFIIAAVSAHEKAMREQAKKMNVKSLRSSEDAE 267

  Fly   269 NMSVELRIAKAALIIYMLFILAWTPYSVVALIGCFGEQQLITPFVSMLPCLACKSVSCLDPWVYA 333
            . |.|.::||.||:...|:.:|||||.|:..:|.|..:.| ||..::......||.:|.:|.||.
  Fly   268 K-SAEGKLAKVALVTITLWFMAWTPYLVINCMGLFKFEGL-TPLNTIWGACFAKSAACYNPIVYG 330

  Fly   334 TSHPKYRLELERRLPWLGIREKHATSGTSGGQESVASVS 372
            .|||||||.|:.:.|.....:  ...|.|...:|.|:.|
  Fly   331 ISHPKYRLALKEKCPCCVFGK--VDDGKSSDAQSQATAS 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh5NP_001285859.1 7tm_4 60..>236 CDD:304433 69/182 (38%)
7tm_1 69..332 CDD:278431 107/268 (40%)
ninaENP_524407.1 7tmA_photoreceptors_insect 52..340 CDD:320207 118/294 (40%)
TM helix 1 53..77 CDD:320207 9/23 (39%)
TM helix 2 86..108 CDD:320207 12/21 (57%)
TM helix 3 124..146 CDD:320207 7/21 (33%)
TM helix 4 168..184 CDD:320207 3/19 (16%)
TM helix 5 212..235 CDD:320207 6/22 (27%)
TM helix 6 275..297 CDD:320207 11/21 (52%)
TM helix 7 308..333 CDD:320207 7/24 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461673
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42416
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24240
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.