DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh5 and opn1mw3

DIOPT Version :9

Sequence 1:NP_001285859.1 Gene:Rh5 / 34615 FlyBaseID:FBgn0014019 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_878312.1 Gene:opn1mw3 / 360152 ZFINID:ZDB-GENE-030728-6 Length:349 Species:Danio rerio


Alignment Length:351 Identity:94/351 - (26%)
Similarity:146/351 - (41%) Gaps:50/351 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 INGPSGPQAYVNDSLGDGSVFPMGHGYPAEYQHMVHAHWRGFREAPIYYHA---GFYIAFIVLML 64
            :||..|...|:..|...|.|     ..|.||              |.||.|   .|.:..:.:..
Zfish     1 MNGTEGNNFYIPMSNRTGLV-----RSPYEY--------------PQYYLAEPWQFKLLAVYMFF 46

  Fly    65 SSIFG---NGLVIWIFSTSKSLRTPSNLLILNLAIFDLFM-CTNMPHYLINATVGYIVGGDLGCD 125
            ...||   |||.:.:.:..|.||.|.|.:::|||:....| |.........|..||.|.|..|| 
Zfish    47 LMCFGFPINGLTLVVTAQHKKLRQPLNFILVNLAVAGTIMVCFGFTVTFYTAINGYFVLGPTGC- 110

  Fly   126 IYALNGGISGMGASI---TNAFIAFDRYKTISNPIDG-RLSYGQIVLLILFTWLWATPFSVLPLF 186
              |:.|.::.:|..|   :...:|.:||..:..|:.. :.|.......|.|||:.|...:..||.
Zfish   111 --AIEGFMATLGGQISLWSLVVLAIERYIVVCKPMGSFKFSSNHAFAGIGFTWIMALSCAAPPLV 173

  Fly   187 QIWGRYQPEGFLTTCSFDYLT-NTD-ENRLFVRTIFVWSYVIPMTMILVSYYKLFTHVRVHEKML 249
            . |.||.|||...:|..||.| |.| .|..:|..:|...::.|:|.|..:|.:|...|:      
Zfish   174 G-WSRYIPEGMQCSCGPDYYTLNPDYNNESYVLYMFCCHFIFPVTTIFFTYGRLVCTVK------ 231

  Fly   250 AEQAKKMNVKSLSANANADNMSVELRIAKAALIIYMLFILAWTPYSVVALIGCFGEQQLITPFVS 314
            |..|::...:|        ....|..:.:..:::.:.|::|||||:.||....|......:....
Zfish   232 AAAAQQQESES--------TQKAEREVTRMVILMVLGFLVAWTPYASVAAWIFFNRGAAFSAQFM 288

  Fly   315 MLPCLACKSVSCLDPWVYATSHPKYR 340
            .:|....||.|..:|.:|...:.::|
Zfish   289 AVPAFFSKSSSIFNPIIYVLLNKQFR 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh5NP_001285859.1 7tm_4 60..>236 CDD:304433 56/185 (30%)
7tm_1 69..332 CDD:278431 76/272 (28%)
opn1mw3NP_878312.1 Rhodopsin_N 2..37 CDD:287397 14/53 (26%)
7tm_4 45..>248 CDD:304433 62/220 (28%)
7tm_1 55..306 CDD:278431 75/268 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 329..349
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48050
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.