DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh5 and Rrh

DIOPT Version :9

Sequence 1:NP_001285859.1 Gene:Rh5 / 34615 FlyBaseID:FBgn0014019 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_006232065.1 Gene:Rrh / 310869 RGDID:1308948 Length:337 Species:Rattus norvegicus


Alignment Length:335 Identity:89/335 - (26%)
Similarity:158/335 - (47%) Gaps:61/335 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DGSVFPMGHGYPAEYQHMVHAHWRGFREAPIYYHAGFYIAFIVLMLSSIFGNGLVIWIFSTSKSL 83
            :||||       .:.:|.:.|.:                 .||..:.||..|.:|:.||...|.|
  Rat    16 EGSVF-------TKSEHSIIAAY-----------------LIVAGIISILSNIIVLGIFIKYKEL 56

  Fly    84 RTPSNLLILNLAIFDLFMCTNMPHYLINATVGYIVG-----------GDLGCDIYALNGGISGMG 137
            |||:|.:|:|||..|:.:          :::||.:.           |..||.:||......||.
  Rat    57 RTPTNAVIINLAFTDIGV----------SSIGYPMSAASDLHGSWKFGHAGCQVYAGLNIFFGMV 111

  Fly   138 ASITNAFIAFDRYKTISNPIDGRLSYGQIVL-LILFTWLWATPFSVLPLFQIWGRYQPEGFLTTC 201
            :......:|.|||.|||.|..||...|...| ::|..|:....::::|:.. |..|.|:....||
  Rat   112 SIGLLTVVALDRYLTISCPDVGRRMTGNTYLSMVLGAWINGLFWALMPIVG-WASYAPDPTGATC 175

  Fly   202 SFDYLTNTDENRLFVRTIFVWSYVIPMTMILVSYYKLFTHVRVHEKMLAEQAKKMNVKS-LSANA 265
            :.::..|......:...:.|.::::|:|::...||    ||        .|:.:::..| .:.:.
  Rat   176 TINWRKNDTSFVSYTMMVIVVNFIVPLTVMFYCYY----HV--------SQSMRLSAASNCTTHL 228

  Fly   266 NADNMSVELRIAKAALIIYMLFILAWTPYSVVALIGCFGEQQLITPFVSMLPCLACKSVSCLDPW 330
            |.| .:.:..:.|.::::.::|:|||:|||||.|..|||..:.|.|.::::..|..||.:..:|.
  Rat   229 NRD-WAHQADVTKMSVMMILMFLLAWSPYSVVCLWACFGNPKKIPPSLAIIAPLFAKSSTFYNPC 292

  Fly   331 VYATSHPKYR 340
            :|..::.|:|
  Rat   293 IYVAANKKFR 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh5NP_001285859.1 7tm_4 60..>236 CDD:304433 52/187 (28%)
7tm_1 69..332 CDD:278431 76/275 (28%)
RrhXP_006232065.1 7tm_1 43..294 CDD:278431 76/274 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48050
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.