DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh5 and Opn4

DIOPT Version :9

Sequence 1:NP_001285859.1 Gene:Rh5 / 34615 FlyBaseID:FBgn0014019 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_038915.1 Gene:Opn4 / 30044 MGIID:1353425 Length:521 Species:Mus musculus


Alignment Length:403 Identity:128/403 - (31%)
Similarity:205/403 - (50%) Gaps:55/403 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 INGPSGPQAYVNDSLGDGSVF---PMGHGY-----------------PAEYQHMVHAHWRGFREA 47
            ::.||||:  |..||.....|   |...|.                 |....|.. |.|..|...
Mouse     1 MDSPSGPR--VLSSLTQDPSFTTSPALQGIWNGTQNVSVRAQLLSVSPTTSAHQA-AAWVPFPTV 62

  Fly    48 PIYYHAGFYIAFIVLM--LSSIFGNGLVIWIFSTSKSLRTPSNLLILNLAIFDLFM-CTNMPHYL 109
            .:..||.:.:..::|:  |:.:.||..||:.|..::.||||:|:.|:|||:.|..| .|..|.:.
Mouse    63 DVPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRNRGLRTPANMFIINLAVSDFLMSVTQAPVFF 127

  Fly   110 INATVGYIVGGDLGCDIYALNGGISGMGASITNAFIAFDRYKTISNPID--GRLSYGQIVLLILF 172
            .::.....:.|:.||:.||..|.:.|:.:.||...||.|||..|:.|:.  ||.|..:..|::|.
Mouse   128 ASSLYKKWLFGETGCEFYAFCGAVFGITSMITLTAIAMDRYLVITRPLATIGRGSKRRTALVLLG 192

  Fly   173 TWLWATPFSVLPLFQIWGRYQPEGFLTTCSFDYLTNTDENRLFVRTIFVWSYVIPMTMILVSYYK 237
            .||:|..:|:.|.|. |..|.|||.||:||:||:|.|.:.|.:...:|.:.:.:|:.:|:..|..
Mouse   193 VWLYALAWSLPPFFG-WSAYVPEGLLTSCSWDYMTFTPQVRAYTMLLFCFVFFLPLLIIIFCYIF 256

  Fly   238 LFTHVR--------VHEKMLAEQAKKMNVKSLSANANADNMSVELRIAKAALIIYMLFILAWTPY 294
            :|..:|        ..|..|.::.:...::|            |.::||.|||:.:||:|:|.||
Mouse   257 IFRAIRETGRACEGCGESPLRQRRQWQRLQS------------EWKMAKVALIVILLFVLSWAPY 309

  Fly   295 SVVALIGCFGEQQLITPFVSMLPCLACKSVSCLDPWVYATSHPKYRLELERRLPWLGIREKHATS 359
            |.|||:...|...::||::|.:|.:..|:.:..:|.:||.:|||||:.:.:.||.||:     ..
Mouse   310 STVALVAFAGYSHILTPYMSSVPAVIAKASAIHNPIIYAITHPKYRVAIAQHLPCLGV-----LL 369

  Fly   360 GTSGGQESVASVS 372
            |.| ||.|..|:|
Mouse   370 GVS-GQRSHPSLS 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh5NP_001285859.1 7tm_4 60..>236 CDD:304433 64/180 (36%)
7tm_1 69..332 CDD:278431 91/273 (33%)
Opn4NP_038915.1 7tm_4 77..>244 CDD:304433 62/167 (37%)
7tm_1 86..347 CDD:278431 91/273 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 445..486
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845795
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42416
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24240
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.