DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh5 and Olfr109

DIOPT Version :9

Sequence 1:NP_001285859.1 Gene:Rh5 / 34615 FlyBaseID:FBgn0014019 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_667046.1 Gene:Olfr109 / 258832 MGIID:2177492 Length:314 Species:Mus musculus


Alignment Length:331 Identity:63/331 - (19%)
Similarity:118/331 - (35%) Gaps:93/331 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 YIAFIVLMLSSIFGNGLVIWIFSTSKSLRTPSNLLILNLAIFDL-FMCTNMPHYLINATVGYIVG 119
            ::.|:.:.|.::.|||:::.|.:..:.|.:|....:.||:..|: :....:|..|||........
Mouse    26 FVMFLTIYLLNLVGNGVILMIVTLERRLHSPMYFFLGNLSCLDICYSSVTLPKVLINLLSRRRAI 90

  Fly   120 GDLGC--DIYALNGGISGMGASITNAFIAFDRYKTISNPIDGRLSYGQIVLLILFTWLWATPFSV 182
            ..|||  .:|..:  ..|...:|..|.:||||:..|.:|:.........:.::|....|.|.|..
Mouse    91 SFLGCITQLYFFH--FLGSTEAILLAVMAFDRFVAICSPLRYTAIMNPQLCILLAATAWFTSFFY 153

  Fly   183 LPLFQIWGRYQPEGFLTTCSFDYLT---------------NTDENRLFVRTIFVWSYVIPMTMIL 232
            ..|..:...:     |..|....|:               ||..|:..:..:.....:....:||
Mouse   154 ALLHSVMTAH-----LNFCHSHKLSHFFCDVKPLLEVACGNTVLNQWLLSVVTGSISMGAFLLIL 213

  Fly   233 VSYYKLFTHVRVHEKMLAEQAKKMNVKSLS-----------------------ANANADNMSVEL 274
            :||:.:...:     :...::.:|..|:||                       |.|:|.:||.:.
Mouse   214 LSYFYIIAFL-----LFKNRSCRMLKKALSTCTSHFMVVCLFYGPVGFTYIRPATASASSMSEDR 273

  Fly   275 RIAKAALIIYMLFILAWTPYSVVALIGCFGEQQLITPFVSMLPCLACKSVSCLDPWVYATSHPKY 339
            .:|    |||                      ..:||              .|:|.:|...:.:.
Mouse   274 VVA----IIY----------------------SAVTP--------------VLNPLIYTLRNKEV 298

  Fly   340 RLELER 345
            .|.|::
Mouse   299 MLALKK 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh5NP_001285859.1 7tm_4 60..>236 CDD:304433 41/193 (21%)
7tm_1 69..332 CDD:278431 58/303 (19%)
Olfr109NP_667046.1 7tm_4 29..309 CDD:304433 63/328 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7519
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.