DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh5 and OPN5

DIOPT Version :9

Sequence 1:NP_001285859.1 Gene:Rh5 / 34615 FlyBaseID:FBgn0014019 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_016865905.1 Gene:OPN5 / 221391 HGNCID:19992 Length:408 Species:Homo sapiens


Alignment Length:296 Identity:84/296 - (28%)
Similarity:145/296 - (48%) Gaps:27/296 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 AGFYIAFIVLMLSSIFGNGLVIWIFSTSKSLRTPSNLLILNLAIFDL-FMCTNMPHYLINATVGY 116
            ||||:..|.::  |.||||.|:::.|..|....|:.::.:|||:.|| ......|..:|:.....
Human    36 AGFYLTIIGIL--STFGNGYVLYMSSRRKKKLRPAEIMTINLAVCDLGISVVGKPFTIISCFCHR 98

  Fly   117 IVGGDLGCDIYALNGGISGMGASITNAFIAFDRYKTISNPIDGRLSYG------QIVLLILFTWL 175
            .|.|.:||..|...|...|.|:.||...::.|||..|.     .||||      ...:.:...|.
Human    99 WVFGWIGCRWYGWAGFFFGCGSLITMTAVSLDRYLKIC-----YLSYGVWLKRKHAYICLAAIWA 158

  Fly   176 WATPFSVLPLFQIWGRYQPEGFLTTCSFD-YLTNTD-ENRLFVRTIFVWSYVIPMTMILVSYYKL 238
            :|:.::.:||..: |.|.||.|.|:|:.| :|.... ..::|:..|..:..::|..:|:.||.|:
Human   159 YASFWTTMPLVGL-GDYVPEPFGTSCTLDWWLAQASVGGQVFILNILFFCLLLPTAVIVFSYVKI 222

  Fly   239 FTHVRVHEKMLAEQAKKMNVKSLSANANADNMSVELRIAKAALIIYMLFILAWTPYSVVALIGCF 303
            ...|:...|.:|....:::...:          :|:::.|.|::|...|::||.||:||::...|
Human   223 IAKVKSSSKEVAHFDSRIHSSHV----------LEMKLTKVAMLICAGFLIAWIPYAVVSVWSAF 277

  Fly   304 GEQQLITPFVSMLPCLACKSVSCLDPWVYATSHPKY 339
            |....|...:|::|.|..||.:..:|.:|.....|:
Human   278 GRPDSIPIQLSVVPTLLAKSAAMYNPIIYQVIDYKF 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh5NP_001285859.1 7tm_4 60..>236 CDD:304433 53/184 (29%)
7tm_1 69..332 CDD:278431 75/271 (28%)
OPN5XP_016865905.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.