DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh5 and Rrh

DIOPT Version :9

Sequence 1:NP_001285859.1 Gene:Rh5 / 34615 FlyBaseID:FBgn0014019 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_033128.1 Gene:Rrh / 20132 MGIID:1097709 Length:337 Species:Mus musculus


Alignment Length:371 Identity:97/371 - (26%)
Similarity:173/371 - (46%) Gaps:63/371 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SLGDGSVFPMGHGYPAEYQHMVHAHWRGFREAPIYYHAGFYIAFIVLMLSSIFGNGLVIWIFSTS 80
            |..:||||       :..:|.|.|.:                 .||..::||..|.:|:.||...
Mouse    13 SRSEGSVF-------SRTEHSVIAAY-----------------LIVAGITSILSNVVVLGIFIKY 53

  Fly    81 KSLRTPSNLLILNLAIFDLFMCTNMPHYLINATVGYIVG-----------GDLGCDIYALNGGIS 134
            |.||||:|.:|:|||..|:.:          :::||.:.           |..||.|||......
Mouse    54 KELRTPTNAVIINLAFTDIGV----------SSIGYPMSAASDLHGSWKFGHAGCQIYAGLNIFF 108

  Fly   135 GMGASITNAFIAFDRYKTISNP-IDGRLSYGQIVLLILFTWLWATPFSVLPLFQIWGRYQPEGFL 198
            ||.:......:|.|||.|||.| :..|::....:.:||..|:....::::|:.. |..|.|:...
Mouse   109 GMVSIGLLTVVAMDRYLTISCPDVGRRMTTNTYLSMILGAWINGLFWALMPIIG-WASYAPDPTG 172

  Fly   199 TTCSFDYLTNTDENRLFVRTIFVWSYVIPMTMILVSYYKLFTHVRVHEKMLAEQAKKMNVKSLSA 263
            .||:.::..|......:...:.|.::::|:|::...||.:...:|::.           ....:|
Mouse   173 ATCTINWRNNDTSFVSYTMMVIVVNFIVPLTVMFYCYYHVSRSLRLYA-----------ASDCTA 226

  Fly   264 NANADNMSVELRIAKAALIIYMLFILAWTPYSVVALIGCFGEQQLITPFVSMLPCLACKSVSCLD 328
            :.:.| .:.:..:.|.::|:.::|:|||:|||:|.|..|||..:.|.|.::::..|..||.:..:
Mouse   227 HLHRD-WADQADVTKMSVIMILMFLLAWSPYSIVCLWACFGNPKKIPPSMAIIAPLFAKSSTFYN 290

  Fly   329 PWVYATSHPKYR---LELERRLPWLGIREKHATSGTSGGQESVASV 371
            |.:|..:|.|:|   |.:.:..|.|.:.|. :|......|.|:|.|
Mouse   291 PCIYVAAHKKFRKAMLAMFKCQPHLAVPEP-STLPMDMPQSSLAPV 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh5NP_001285859.1 7tm_4 60..>236 CDD:304433 51/187 (27%)
7tm_1 69..332 CDD:278431 72/274 (26%)
RrhNP_033128.1 7tm_1 43..294 CDD:278431 72/273 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48050
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.