DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh5 and Opn4

DIOPT Version :9

Sequence 1:NP_001285859.1 Gene:Rh5 / 34615 FlyBaseID:FBgn0014019 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_620215.1 Gene:Opn4 / 192223 RGDID:621701 Length:474 Species:Rattus norvegicus


Alignment Length:373 Identity:122/373 - (32%)
Similarity:197/373 - (52%) Gaps:25/373 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SVFPMGHGYPAEYQHMVHAHWRGFREAPIYYHAGFYIAFIVLM--LSSIFGNGLVIWIFSTSKSL 83
            ||.|...|..|       |.|..|....:..||.:.:..::|:  |:.:.||..||:.|..::.|
  Rat    44 SVSPTTPGLQA-------AAWVPFPTVDVPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRNRGL 101

  Fly    84 RTPSNLLILNLAIFDLFMC-TNMPHYLINATVGYIVGGDLGCDIYALNGGISGMGASITNAFIAF 147
            |||:|:||:|||:.|..|. |..|.:..::.....:.|:.||..||..|.:.|:.:.||...||.
  Rat   102 RTPANMLIINLAVSDFLMSFTQAPVFFASSLYKKWLFGETGCKFYAFCGAVFGIVSMITLTAIAM 166

  Fly   148 DRYKTISNPID--GRLSYGQIVLLILFTWLWATPFSVLPLFQIWGRYQPEGFLTTCSFDYLTNTD 210
            |||..|:.|:.  |..|..:..|::|..||:|..:|:.|.|. |..|.|||.||:||:||:|.|.
  Rat   167 DRYLVITRPLATIGMRSKRRTALVLLGVWLYALAWSLPPFFG-WSAYVPEGLLTSCSWDYVTFTP 230

  Fly   211 ENRLFVRTIFVWSYVIPMTMILVSYYKLFTHVRVHEKMLAEQAKKMNVKSLSANANADNMSVELR 275
            ..|.:...:|.:.:.:|:.:|:..|..:|..:|.     ..:|.:...:|.........:..|.:
  Rat   231 LVRAYTMLLFCFVFFLPLLIIIFCYIFIFRAIRE-----TGRACEGCGESPLRRRQWQRLQSEWK 290

  Fly   276 IAKAALIIYMLFILAWTPYSVVALIGCFGEQQLITPFVSMLPCLACKSVSCLDPWVYATSHPKYR 340
            :||.|||:.:||:|:|.|||.|||:|..|...::||::|.:|.:..|:.:..:|.:||.:|||||
  Rat   291 MAKVALIVILLFVLSWAPYSTVALVGFAGYSHILTPYMSSVPAVIAKASAIHNPIIYAITHPKYR 355

  Fly   341 LELERRLPWLGI-------REKHATSGTSGGQESVASVSGDTLALSVQ 381
            ..:.:.||.||:       |...:.|..|..:.:::|.|.|...:|.|
  Rat   356 AAIAQHLPCLGVLLGVSGQRSHPSLSYRSTHRSTLSSQSSDLSWISGQ 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh5NP_001285859.1 7tm_4 60..>236 CDD:304433 64/180 (36%)
7tm_1 69..332 CDD:278431 91/265 (34%)
Opn4NP_620215.1 7tm_4 78..>245 CDD:304433 62/167 (37%)
7tm_1 87..347 CDD:278431 91/265 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 428..474
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349212
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44480
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24240
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.